(data stored in ACNUC8465 zone)

EMBL: CP000828.PE596

CP000828.PE596       Location/Qualifiers
FT   CDS_pept        complement(625267..626484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25687"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4E4"
FT                   /protein_id="ABW25687.1"
FT                   /translation="MKTNFSQIITPHCHATAHAITEEEITLCVGDTSFLDYGGIKKKRQ
FT                   GYGPQGNGGNGLLLHSALAVDPEQGQPLGLLWQKVWNRQHRPQPPKKETPRQKKKRQAK
FT                   ARQTSRNRPFEQKASYRWVEAMQAVEKIVSPSTRSIHVFDREGDIAEVFERLNHLNNTG
FT                   VVVRASHNRRLEQDPNRLWKKLEAQSIQFEYEIDLPKTKDRSARTAKLVVRCCLVQLQR
FT                   PTRLADSHPLQVYAVYATEVDPPEDEDPVSWMLLTSEAVTTMEMAQTILRWYTYRWRVE
FT                   EYHKILKSGTQVERYRLAAEGMKTLLGFLCVTAVELLRWTYLERTSPQRPAQDVVTPLQ
FT                   IKVLRAKTSKVPKNLTVAWAVKAVARLGGYLEHRRNTPMGIQVLWKGWAKLNLLVEGWQ
FT                   LATQET"
     gtgaaaacca acttctctca aatcattact cctcattgcc atgcaactgc ccatgccatc        60
     accgaggaag agattacctt gtgcgtgggt gatacgagct ttttagacta cggaggcatc       120
     aagaagaagc gtcaaggcta tggtcctcaa ggcaatgggg ggaatggctt attgctccac       180
     agtgccttag ctgttgaccc cgagcaaggc caaccattgg ggttgctatg gcaaaaggta       240
     tggaatcgtc agcatcgacc ccagcctccg aaaaaggaaa cccctcgaca aaagaagaag       300
     cgtcaggcaa aggcgcgaca aacttctcgg aaccgaccct ttgaacaaaa ggcatcctat       360
     cggtgggtcg aagcgatgca agccgtagaa aagatagtga gtccttctac tcgttccatt       420
     catgtgtttg accgagaagg agatattgcc gaagtgtttg agcggctcaa tcacctcaac       480
     aacacagggg ttgtggttag agcctcacat aatcgtcggc ttgagcaaga ccccaatcga       540
     ctgtggaaaa aactggaagc ccaaagtatt caattcgagt atgaaattga cttacccaaa       600
     acgaaagacc ggagtgcacg tacagccaag ctagtggtgc gctgttgtct cgtccaactg       660
     cagcgaccta cccgtctagc tgatagtcat cccctccagg tatacgccgt ctatgccaca       720
     gaagtagatc ccccagagga tgaagaccca gtgtcatgga tgttgctcac gagtgaagca       780
     gtcaccacta tggaaatggc tcagaccatt ttgcgctggt acacgtacag gtggagagtg       840
     gaggaatatc acaaaattct caaatcgggg actcaggtgg agcggtatcg tttggctgct       900
     gaggggatga aaaccttatt aggattcctg tgtgtcactg ctgtagaact gttacgctgg       960
     acctacttag aacgcacatc ccctcaacgg cctgctcaag atgtcgtcac acctttacag      1020
     attaaagttc tcagagcgaa gacatcgaag gttcccaaaa acctcacggt tgcatgggca      1080
     gtgaaagcag ttgcacgact tggaggatat ctggagcatc gtcgcaacac accgatgggg      1140
     attcaagtgc tttggaaagg atgggctaag ttaaatctcc tagtcgaggg ctggcagtta      1200
     gcgacccagg agacttag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page