(data stored in ACNUC5340 zone)

EMBL: CP000828.PE6

CP000828.PE6         Location/Qualifiers
FT   CDS_pept        7272..8051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25097"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Y5"
FT                   /protein_id="ABW25097.1"
FT                   /translation="MSQVPNLNTLFQSAQADGVLSNASMQALNVVDIGAQIQAGLGTPV
FT                   DDVMASEVVLVTIMPDDSGSIRFAGNGAVVRAGHNMVLDTLAMSPQQDQILVHNRYLNG
FT                   AVLYPYCPVDQALRMDQHNYDPNLGTPLYDQTLVLLATVLAKAQAFIDNGVPARTVSLI
FT                   ITDGADAHSRRSVREVKGVVEDMLRTEDHIIAAMGINDGQTDFKRVFREMGVRDQWILT
FT                   PGNSQNEIRKAFQLFSQSVLRASQSAHNFNSWGGFGP"
     atgtctcaag ttcccaattt aaatacgtta ttccaatctg cccaagcgga tggggtactc        60
     tctaatgcat cgatgcaggc tctcaatgtt gtcgatattg gggcgcaaat ccaggcggga       120
     ctgggaacac cggtggatga tgtgatggcc agtgaggtgg tgctggtgac gattatgccg       180
     gatgattcgg ggtcgattcg gtttgcgggc aatggggcgg tggtccgagc ggggcataat       240
     atggtgctgg ataccttggc tatgtccccg caacaagatc agattctggt tcacaaccgc       300
     tatctcaatg gggcagtgct ttatccctac tgtcctgttg accaagcgct tcggatggat       360
     caacacaatt atgatccgaa tctaggtacg ccgctctatg accaaaccct ggtgttactc       420
     gctacggtgc tggcgaaggc ccaagctttt atcgataatg gagtgccggc acggacggtg       480
     tcgctgatta ttacggatgg ggcggatgcc cattctcggc gctcggtacg cgaagtcaag       540
     ggggtggtcg aggatatgct aagaacggaa gaccatatta ttgcggcgat gggcatcaat       600
     gatggacaga cggactttaa acgagtgttt cgagagatgg gggtgcgtga tcaatggatc       660
     ttgacgcccg gcaattctca aaatgagatt cgtaaggcgt ttcaactgtt ctctcagtcg       720
     gtattgaggg ccagtcagtc ggcgcacaac tttaattcct ggggcggttt tggaccttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page