(data stored in ACNUC27125 zone)

EMBL: CP000828.PE603

CP000828.PE603       Location/Qualifiers
FT   CDS_pept        631592..633139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25694"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE60"
FT                   /protein_id="ABW25694.1"
FT                   /translation="MFALCVVGFNQPPSPTIQATQPVSNPQLGMNLGEVVSYTSQWPFV
FT                   DAFKLSRPWFSGREGAGFDQGGPLKLTPEGWIAALEPKQFAETVIFDNGKGHYPAGKYT
FT                   LLYDGEGEISFNYGSATIASQQPGRMVLDVTPMETGIWLKINRTNPQNPIRNIRLILPG
FT                   FEYAYQQRLFHPLFLERLQPFKTLRFMDWMETNGSDIQEWQDRPQVSDVTQAAGKGVAL
FT                   EYMIDLANTLQANPWFTLPHQASDDYVRQFATMVRDRLDPRLKVYVEYSNEVWNTAPDF
FT                   NQYQYAQSKGLELKLAEDPYQASLRFYSQRSVEIFKLWESVFGSRDRLVRVLASQYVNP
FT                   WTAEQVLTWKDAYKSADAYAIAPYFSGEWDYLENLPRLLKSSEAEIWQQMEAEIKSYGP
FT                   FLREHYSRIRDEFGLDLIAYEGGQHLTSAAFSEEHEQKITQLFTSLNRHPRMATLYKQY
FT                   LQQWQESGGGLLCHFVDVSPYTRFGSWGALEYQNQPLETAPKYQALVDFMAQGSAQQ"
     atgtttgcgt tatgtgtggt cgggtttaat cagccgccct ctcctactat ccaggctacc        60
     cagccggtct ctaatccaca actcgggatg aatttagggg aggtggtgag ttacaccagt       120
     caatggccgt ttgtggatgc ttttaagcta tcgcgccctt ggttctcggg gcgggaaggg       180
     gctggttttg atcagggagg ccccctgaag ctcactcctg agggctggat tgcagcccta       240
     gaacccaagc agtttgcgga gaccgtgatc tttgacaatg gcaaaggtca ttacccggcg       300
     gggaaataca ccctgctgta tgacggagag ggagagatta gctttaacta tggtagtgcc       360
     accattgcga gtcagcagcc tggacggatg gtattggacg taacgccgat ggagacgggg       420
     atttggttga aaattaatcg aacaaatccc caaaatccca ttcggaatat tcgcttgatt       480
     ttacctggat ttgaatatgc ctatcagcaa cgtctttttc atccattgtt tctagagcgg       540
     ctgcagccct tcaaaacctt gcggtttatg gattggatgg aaacgaatgg ctctgacatt       600
     caagagtggc aggatcggcc tcaagtgtcg gatgtgaccc aagcggctgg caagggagtg       660
     gctttagagt acatgatcga tctggccaat actctacaag ccaatccttg gtttaccttg       720
     ccccatcagg cctcggatga ttatgttcgt caattcgcga cgatggtacg cgatcggtta       780
     gaccctcggc tcaaggtgta cgtggagtac tctaacgagg tgtggaacac cgcccccgac       840
     tttaatcaat atcagtatgc tcaatccaaa ggattggaat taaagcttgc agaagacccc       900
     tatcaagcta gcttacgctt ctactcccaa agatctgttg agattttcaa actttgggaa       960
     tcggtatttg gcagccgcga tcgcctagtg agagtattag catcccagta tgtcaacccc      1020
     tggaccgctg agcaggtgct gacttggaaa gatgcctata aatccgcaga tgcctatgct      1080
     attgcgcctt acttcagtgg ggaatgggat tatctggaga atttaccccg attactcaag      1140
     agttctgaag ccgaaatttg gcaacagatg gaggcagaaa ttaagtccta tgggccgttt      1200
     ctgcgggagc actatagccg tattcgagac gagtttgggt tggatttgat tgcctatgag      1260
     ggaggacagc atttaaccag tgctgcattt agcgaagaac atgagcagaa gattactcaa      1320
     ctgtttacct cccttaaccg tcacccccgc atggccactc tgtataagca gtatctccag      1380
     caatggcagg agtccggtgg aggattgctc tgtcattttg tagatgtttc gccctatacc      1440
     cgttttggca gttggggagc gctggaatac caaaaccaac cattagaaac tgccccaaaa      1500
     tatcaggcat tagtggactt tatggcgcaa ggttcagctc aacaatga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page