(data stored in ACNUC27125 zone)

EMBL: CP000828.PE610

CP000828.PE610       Location/Qualifiers
FT   CDS_pept        640096..641094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0653"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 3"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25701"
FT                   /db_xref="GOA:B0CE67"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CE67"
FT                   /protein_id="ABW25701.1"
FT                   /translation="MQQMATGLAVTGCGSAAPETSLDNHGLSQIVDTSDEWIASRTGIR
FT                   SRHLAGPDDTLAKLGAIAAQNALEMAQVEATDLDLILLATSTPDDLFGSACQIQAAIGA
FT                   KHAVAFDLTAACSGFVFGMITAAQFIRTGVYRNVLLVGADVLSRWVDWTDRRSCVLFGD
FT                   GAGAVVLQANDTDRLLGFALHSDGCLHDCLNVQYQGEARPLTGEINVSQGTYQPISMNG
FT                   KEVYRFAVNRVPEVVEKALFQSDLKTDDIDWLLLHQANQRILDAVAKRLKVPAEKVISN
FT                   IANYGNTSAATIPLALDATVRKGHIKPGDTIAASGFGAGLSWGAAIFQWQR"
     gtgcagcaaa tggccactgg attggcagtt actgggtgcg gctctgctgc tcctgagact        60
     tccctggata atcatggtct gagccaaatc gttgatacct ctgatgagtg gattgcaagc       120
     cgaacgggca tccgatctcg gcacctcgcg ggtccagatg acacgttggc aaaactgggt       180
     gcgatcgcag cccaaaatgc cttagagatg gcccaagtgg aagccactga tcttgatcta       240
     atactgctgg ccacttcgac ccctgacgat ttgtttggta gtgcctgtca gattcaggct       300
     gcaattggtg caaagcatgc cgttgccttt gacctcactg ctgcctgttc tgggtttgta       360
     tttggcatga ttacggctgc ccaatttatc cgcacggggg tctaccgcaa tgtcctcctg       420
     gtcggagctg atgtgctctc tcgttgggta gactggaccg atcgtcgatc ttgtgtcctc       480
     tttggggacg gagcaggcgc ggtggttctc caagccaatg acaccgatcg cctgctcgga       540
     tttgctttac acagcgacgg ctgtttacat gattgcctca atgtccaata tcagggcgag       600
     gcacgtccct tgactgggga aattaatgtt agtcaaggga catatcaacc tatttccatg       660
     aatgggaagg aagtctaccg gtttgcagtg aatcgagtgc ctgaagtcgt ggagaaggct       720
     ctctttcagt cggacttaaa aacggacgat attgattggt tgctcttgca ccaggcaaat       780
     cagcgcattc tcgatgcggt ggccaagcgc ctcaaggtgc ctgctgagaa ggtgattagt       840
     aatatcgcca actatggcaa tacctctgcc gctacgattc ctttagcgtt ggacgcaacg       900
     gttcgcaaag gtcatatcaa acctggagat acgattgcgg cctctggatt tggggctggc       960
     ttgagttggg gcgcggctat ctttcagtgg cagcgctag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page