(data stored in ACNUC5340 zone)

EMBL: CP000828.PE614

CP000828.PE614       Location/Qualifiers
FT   CDS_pept        complement(643108..643266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25705"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE71"
FT                   /protein_id="ABW25705.1"
FT                   /translation="MQTDLFKVQHTLEGFQQRSVLMLGIHREIFIDALTLPLVCKLNRE
FT                   IIPNDLS"
     ttgcaaactg acctgttcaa agtgcagcat actctagagg gttttcagca aagatcagta        60
     ttgatgctgg gcatccatcg tgaaattttc atcgatgcct tgactctacc gttagtttgc       120
     aagttaaatc gcgaaatcat ccccaacgac ctttcgtga                              159
//

If you have problems or comments...

PBIL Back to PBIL home page