(data stored in ACNUC27125 zone)

EMBL: CP000828.PE616

CP000828.PE616       Location/Qualifiers
FT   CDS_pept        complement(644241..645080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0659"
FT                   /product="SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25707"
FT                   /db_xref="GOA:B0CE73"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE73"
FT                   /protein_id="ABW25707.1"
FT                   /translation="MANFSRTWWGQRFLTAIEQITDPGRLGRGRSYARGNKVKSFTLKD
FT                   GLVKAEVRGSVNPYFGVYKEPLYETSIEFEPISKANWAAAIAFIASKASLISRLMLNEM
FT                   PDNIEDAFAKLDLNLLPRSNTNFKTQCSCPDWSNPCKHIAGVYYLLAAELDQDPFLLFE
FT                   LRGLSRENLQKELAKSPLGQALSAELTAQQTELEPDTSYYTQPLTTPASEIEQLKDFWQ
FT                   GDKRLPQTINAPPSTGVSGILVKTQGDFPAFWPKEQSFLAVMEEFYDRVRDKSSAVL"
     atggctaact tcagtcgaac ctggtgggga caacggttcc ttacagcaat tgagcaaatt        60
     accgatccag ggcgtttggg gcgaggacga tcctatgctc gggggaataa agtcaaaagt       120
     tttactctta aagatgggtt ggtgaaagct gaagttcgcg gctcggtgaa tccttatttt       180
     ggggtttata aagagccttt gtatgaaacc agcattgagt ttgagccgat tagcaaagcc       240
     aattgggcag ctgcgatcgc atttatcgca tccaaagcca gtctgatctc acggctgatg       300
     ctaaacgaaa tgcctgacaa tatcgaagat gcctttgcca agctggattt aaacctgcta       360
     ccccgtagca atacaaattt caagactcaa tgttcttgtc ccgactggag caatccctgc       420
     aaacatattg ctggcgtcta ttacctatta gctgcagagc tggaccaaga cccatttttg       480
     ctgtttgagc tacgaggtct gtctcgggaa aacttacaaa aggaactcgc gaaatccccc       540
     ctcggtcaag cattatccgc tgaactcact gcccagcaaa cagagctgga accagacacc       600
     agctattaca cccagcccct caccaccccc gcatccgaga tcgaacagct caaagacttt       660
     tggcaaggag acaaacgact tccccaaacc attaatgccc caccctcgac gggagtctct       720
     gggattttgg ttaaaaccca aggcgacttt ccagcctttt ggccaaagga gcaatccttc       780
     ctagccgtta tggaagaatt ctatgatcgg gtcagagata aaagttctgc tgtactttga       840
//

If you have problems or comments...

PBIL Back to PBIL home page