(data stored in ACNUC27125 zone)

EMBL: CP000828.PE619

CP000828.PE619       Location/Qualifiers
FT   CDS_pept        647752..648546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25710"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE76"
FT                   /protein_id="ABW25710.1"
FT                   /translation="MGKRVTISPLSISSMFIELLYDDISLGSGSAFYLKNNNRLYLISN
FT                   WHNYSGRNPKTRKPIHKECAIPNKVKVYSYNETDQGFAIEEKVYDLLDNNEISTWYEHC
FT                   ELGSKVDVAALPINDEDLGDVIDIERAIELVDPYDSETIKISDSLFILGYPFGLRVNDS
FT                   LPIWKSATVASEPEIDCGSVPMFYIDTATKAGMSGAPVIMYRKRAIPIFGDGKSSVYHA
FT                   EFIGIYSGRVIPRDLIEVQLGKVWKKSCLPSVLNGSKYSYFA"
     atgggtaagc gagtaacaat aagccccctg agtatatcct caatgtttat tgagctttta        60
     tatgatgata taagcctagg ttcaggtagc gcattttatc taaaaaacaa caacagatta       120
     tacctaataa gtaattggca taattattct gggagaaatc caaaaacgag aaagcctata       180
     cataaagaat gtgcaatacc gaataaggta aaagtttata gttacaacga aaccgatcaa       240
     ggctttgcta ttgaagaaaa ggtttatgat ttattagaca acaatgaaat ttccacttgg       300
     tacgagcatt gtgagctcgg gagtaaggtt gatgtagccg cattacctat caatgatgaa       360
     gatctaggtg atgtcattga cattgaaaga gcgatagaac ttgttgaccc gtacgatagc       420
     gaaaccataa aaattagtga cagtcttttt attcttggtt atccctttgg tttaagggtt       480
     aatgattcac tccctatatg gaagtcagca actgtagcaa gtgaaccaga aatagactgc       540
     ggtagtgttc caatgtttta tattgataca gctacaaaag caggtatgtc aggcgctcct       600
     gttattatgt ataggaaacg agcaatacct atatttggtg atggcaagtc aagtgtgtat       660
     cacgctgaat ttatagggat ttattctggc cgagttatac ctagagattt aatagaggtg       720
     caacttggta aagtttggaa gaagtcttgt ttgccttcag ttttaaatgg tagcaagtac       780
     agctattttg cctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page