(data stored in ACNUC27125 zone)

EMBL: CP000828.PE620

CP000828.PE620       Location/Qualifiers
FT   CDS_pept        complement(648514..648648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25711"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE77"
FT                   /protein_id="ABW25711.1"
FT                   /translation="MLRKIRELMAQFLRTGLVYLPESVTSNKSEGSNLLGKIAVLATI"
     atgctgcgaa agattcgaga actgatggct caatttctac gcacaggatt agtctattta        60
     cctgaaagcg taacgagtaa caaatccgag ggaagcaatt tgttaggcaa aatagctgta       120
     cttgctacca tttaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page