(data stored in ACNUC27125 zone)

EMBL: CP000828.PE622

CP000828.PE622       Location/Qualifiers
FT   CDS_pept        652153..652407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25713"
FT                   /db_xref="GOA:B0CE79"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE79"
FT                   /protein_id="ABW25713.1"
FT                   /translation="MIIPGVAGVVIFGNAALTDWQQLRIDYRAYEDVLRSTDDLSTLFK
FT                   AEAAQNIQRINLFADGVWTLLSGILGAIGLHGWLSNTKS"
     atgattattc cgggggtagc tggagtggtt atttttggca atgcagcctt aaccgattgg        60
     caacagctca gaatcgacta tcgagcctat gaagacgttc ttcgcagtac ggatgattta       120
     tctacgctat ttaaagcaga agccgctcaa aatattcaac ggattaactt gtttgccgat       180
     ggtgtctgga ctttgctgag cggaatctta ggggccattg gcttacatgg ttggttgagc       240
     aacacaaaat catga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page