(data stored in ACNUC27125 zone)

EMBL: CP000828.PE624

CP000828.PE624       Location/Qualifiers
FT   CDS_pept        653201..654508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0667"
FT                   /product="DnaJ domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25715"
FT                   /db_xref="GOA:B0CE81"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE81"
FT                   /protein_id="ABW25715.1"
FT                   /translation="MADLQPYFQLLRVSADVTPAELKAAFRRQARTCHPDLHPDNPAAE
FT                   AEFQRLSEAYDIISEALYPPSPVDGFIHGDGSNGLTNAQALYARGTQKAAERDYIGAIQ
FT                   DYTRAIESDPEFLDAYLKRCQVRFVQGDDEGVLAECAEILGLDDTVAQAYYYQGRARLQ
FT                   LGSAPAAIASYSQAISLDEDYAQAWLHRGRARLEMQEETLAREDLTKAAQLFEAQGEPD
FT                   EVNRVQVILQEMGRSRRSKSEVKVQRQQLREQGLLQDIFTTIPEFFMNPSGGLLPTFAR
FT                   LSARRATEVGLSYAGLSILGFVLAANLFPIVFSSVTLGERFILGAMPFFSLVFLNQLVR
FT                   SLIRARGSWASDIFISGATLLPLSLLMFLSGLVVQFGAAGVWILSFYLGCDSVLMLYVG
FT                   CSQVNNLSEQNATLAVPTLLLITSALTYGTFTIFAS"
     atggcggatt tgcaacctta ctttcaattg cttcgagttt cagcggatgt aacgcctgca        60
     gagcttaagg ctgcctttcg ccgtcaggct agaacctgcc accctgattt acacccagac       120
     aaccctgctg ctgaggctga gtttcaacgt ttgagcgaag cctatgacat tatttctgaa       180
     gccctctatc ctcctagccc agtggatgga tttattcatg gggatggcag taatggttta       240
     accaacgctc aagcattgta tgcccgaggg actcaaaagg ctgctgaaag agactatata       300
     ggggctattc aggactacac ccgagccatt gaatccgatc cagaattctt ggatgcctac       360
     cttaaacggt gtcaggtgcg gtttgttcag ggggatgacg aaggggtact ggcagaatgt       420
     gcggagattt tagggttaga tgatacggtt gcccaggctt actattacca ggggcgagcc       480
     cgattgcagt taggctctgc acccgctgcg atcgcatcct atagccaagc tatttctcta       540
     gatgaagatt atgcccaagc ctggttgcac cgtggacggg ctcgtctgga aatgcaggaa       600
     gagacattgg cccgtgaaga cttaaccaag gccgcacagc tttttgaagc ccaaggtgag       660
     ccagatgaag tcaaccgagt gcaggtgatt ttgcaagaga tgggccggag tcgtcgctcg       720
     aaatctgagg ttaaagtcca aagacagcaa ttaagagagc aaggtctctt acaagatatt       780
     tttacgacga ttcctgagtt ctttatgaac ccaagtggtg gattgttgcc cacctttgcc       840
     cgcttgtctg ctcgacgggc tactgaagtg gggttaagct atgcggggct gtccatactg       900
     gggtttgtgt tagccgctaa cctgtttccg attgtcttta gttcagtcac tttgggcgaa       960
     cggtttatac tcggcgcgat gccatttttt agcttagttt ttttgaatca acttgttcgg      1020
     agtctgattc gtgctcgggg gagttgggcc agcgatattt ttatcagtgg ggcaacgctc      1080
     ttgcccctga gtttgctgat gtttttaagt gggctggtgg ttcaatttgg ggcggctggc      1140
     gtttggattt tatccttcta tctggggtgt gattcggtgt tgatgctgta tgtgggctgc      1200
     tctcaagtga ataacttgtc agagcaaaat gctacattgg ccgttccgac tctattattg      1260
     ataaccagtg cattgaccta tggcactttt acaatatttg ctagctga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page