(data stored in ACNUC8465 zone)

EMBL: CP000828.PE627

CP000828.PE627       Location/Qualifiers
FT   CDS_pept        656620..657117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25718"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE84"
FT                   /protein_id="ABW25718.1"
FT                   /translation="MFLVFFLVSTITVLLMKLPFLKSQRFLSSALAACLVGILLFGNSV
FT                   AALTLNLPQLAAMGASDSALDQRQRVIDEDLKIDPTKLRYRGLEYVQFQPEAERLTDPE
FT                   IKSLIKSDINPEVFAAVASGSVQIFGNVQDIDIARDIVTQIKDIPGVREVMFDIGLEVK
FT                   AE"
     atgttccttg ttttctttct tgtcagtaca atcactgtcc tgctgatgaa acttcctttt        60
     ttgaagtctc aacgatttct gagttcagcc ttggctgcct gcctagtggg tatactcttg       120
     tttggtaata gtgtggccgc tctaaccctt aacctgcctc aattggctgc aatgggagcg       180
     tccgatagcg ccttagatca gcggcaacga gtcattgatg aagatctgaa aattgacccc       240
     accaaattgc gctaccgtgg cttggaatat gtccagttcc aaccagaagc ggaacggctc       300
     actgatccag aaattaaatc tttaatcaaa tcagacatca acccagaggt ctttgccgca       360
     gtagcgagtg gttcagtcca aatttttggc aatgtccaag atattgatat tgctcgtgat       420
     attgtcactc aaatcaaaga tattcccggt gttagagaag tcatgtttga tattggtttg       480
     gaagtcaaag ccgagtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page