(data stored in ACNUC5340 zone)

EMBL: CP000828.PE63

CP000828.PE63        Location/Qualifiers
FT   CDS_pept        complement(62815..63222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25154"
FT                   /db_xref="GOA:B0C542"
FT                   /db_xref="UniProtKB/TrEMBL:B0C542"
FT                   /protein_id="ABW25154.1"
FT                   /translation="MKPCRECQAQISEQALTCPQCGAPYPARTSWDGWGFEYKSSLMIA
FT                   GLPLVHIAFKYRPNRRPVLAKGVIAIGQFGYGVICISQVGVGLISLSQFTLAGFALAQF
FT                   AVAYSLVAQFGIYWAEGRGQWVFKFAELLGF"
     atgaaacctt gtcgtgagtg ccaagctcaa atctctgaac aggcattgac ttgtccccaa        60
     tgtggggcac cctatccagc ccgaacctct tgggatggat ggggttttga gtataaatca       120
     tctctgatga ttgctggttt gccgcttgtg catattgcat tcaagtaccg cccgaatcga       180
     agaccagtgt tggcgaaagg ggtgattgcg attgggcagt ttggctatgg tgtaatctgc       240
     atttcgcagg tgggcgtggg attaatcagc ctcagccagt ttactctggc aggatttgca       300
     ctggctcagt ttgcagttgc ctattctttg gtcgctcagt tcgggattta ttgggctgaa       360
     ggacggggcc aatgggtgtt taaatttgct gaattactgg gattctaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page