(data stored in ACNUC27125 zone)

EMBL: CP000828.PE631

CP000828.PE631       Location/Qualifiers
FT   CDS_pept        661708..662181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25722"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE88"
FT                   /protein_id="ABW25722.1"
FT                   /translation="MRETVYIETSILGYLTARRSRDIIVMANIEITREWWDARRPDFQL
FT                   YSSQAVVQETTQGDAEIAAQRLDILSDISLLDLDQAVLELATAFLERSNLPAKANVDAI
FT                   HIAVATVHGMDYVLTWNCKHIANAQIQRKLAEVSLALGYALPILCTPYELLGG"
     atgcgtgaaa ctgtctatat tgagaccagt atattaggct atctcacggc tcggcggagc        60
     agggatatta ttgtgatggc taatattgaa atcacgcgag agtggtggga tgcccgtcgt       120
     cctgactttc aactttattc ttcccaagcc gttgtgcaag agaccaccca gggagatgct       180
     gaaattgcag ctcaacgatt agacattttg agtgatattt ctctgctgga cttggaccaa       240
     gctgtccttg agttggcgac ggcatttttg gagcgtagca acttgcctgc taaagcaaat       300
     gttgatgcta ttcatattgc ggtggcaacg gttcatggta tggattacgt gctgacctgg       360
     aactgtaaac acattgctaa tgctcagatt cagcggaaac tagcggaggt tagtctggct       420
     ttaggatatg cattgccgat tctttgtaca ccctatgaac tcctgggagg ttaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page