(data stored in ACNUC27125 zone)

EMBL: CP000828.PE632

CP000828.PE632       Location/Qualifiers
FT   CDS_pept        662184..662345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25723"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE89"
FT                   /protein_id="ABW25723.1"
FT                   /translation="MYQDEIVEEVHKIREQYACAWNNDLNAIFADLQRQQAEGGRSVVN
FT                   LSQRSGSG"
     atgtatcaag atgagattgt ggaagaggtt cacaagattc gtgaacagta tgcctgtgct        60
     tggaacaatg atttaaatgc tatttttgct gatttgcaaa ggcaacaagc tgaaggtgga       120
     aggagcgtcg tcaatttgtc gcaacgttcc ggttcgggat ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page