(data stored in ACNUC8465 zone)

EMBL: CP000828.PE635

CP000828.PE635       Location/Qualifiers
FT   CDS_pept        complement(664286..665434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0678"
FT                   /product="type I restriction-modification enzyme S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25726"
FT                   /db_xref="GOA:B0CE92"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE92"
FT                   /protein_id="ABW25726.1"
FT                   /translation="MKLKEVCRFLNGGTPSKKKPEYFEGEIPWITGADINGPIVNSARS
FT                   YITEEAILNSATKRVPPNTVLLVTRTSVGKVAVSGMELCYSQDITSLWPDLEKLDIYYL
FT                   THFLRSRETYLKGQSRGATIKGVTKGVLENLSLHLPPIAEQKRIAGILDAADALRVKRR
FT                   DAISTLDALLQSTFLTLFGDPITNPMGWDASDLEAVSEKITDGTHKTPKYTESGIEFLS
FT                   AKDIKNGSIKWNTGKFISEDEHKSLITRCHPEIGDVLLAKSGSLGSVAIIDRDHEFSLF
FT                   ESLCLIKHNRQKIEAQFLTAMLESPRMQMHLLSRNKGISIKHLHLTDIRKLKILLPPLD
FT                   KQRKFATIVASIEKQKAQQCAHLAELDTLFASLQSRAFNGEL"
     atgaagctta aggaggtttg taggttttta aatggtggaa caccaagtaa gaagaagccg        60
     gaatactttg aaggggaaat tccttggatc acaggtgcag acatcaatgg gcctatcgtt       120
     aactcagcta gaagctatat cactgaagaa gcaattctaa actcagcaac gaagcgtgtt       180
     ccaccaaata cagtactctt agtcactcga actagcgtag gaaaagttgc tgtttcaggg       240
     atggagcttt gttatagcca agacatcaca tcactgtggc cagatttaga aaagttagat       300
     atttactatc tgactcattt tcttcgatca agagaaactt atttaaaagg tcaatctcga       360
     ggcgcgacaa tcaaaggcgt aacgaaggga gtcttggaga acctttctct tcatcttcca       420
     ccgatcgcag aacaaaaacg gattgcgggg attctggatg cggcggatgc tttgcgggtt       480
     aagagacgag atgcgatctc aactctcgac gccctcctcc aatccacctt cctcaccctc       540
     ttcggcgacc ccatcaccaa tccaatgggc tgggatgcca gcgacttaga ggcagtttcc       600
     gagaaaatta cagatggcac acataaaacg cctaaatata ctgaatcagg tatcgaattt       660
     ctctcagcca aagatattaa aaatggttca attaaatgga atacaggaaa attcattagt       720
     gaggatgagc ataaaagctt aatcactaga tgtcatcccg agataggcga tgttttgcta       780
     gcaaagagtg gttctctagg atctgtggca attattgacc gagaccatga gtttagtttg       840
     ttcgaaagct tatgtcttat caagcataat cgtcagaaga tcgaggcaca atttcttaca       900
     gctatgcttg agagtcctag aatgcaaatg catttattga gcaggaacaa aggtatttct       960
     attaagcatc ttcacctgac tgatatacga aagctcaaga tattgcttcc tcctctcgat      1020
     aagcagcgta agtttgccac tatcgttgca tcaatcgaaa agcaaaaagc gcaacaatgt      1080
     gcccacctcg ccgaacttga caccctcttt gcctctctcc aatcccgcgc cttcaacgga      1140
     gaactataa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page