(data stored in ACNUC27125 zone)

EMBL: CP000828.PE636

CP000828.PE636       Location/Qualifiers
FT   CDS_pept        complement(665431..666576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0679"
FT                   /product="type I restriction modification system M subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25727"
FT                   /db_xref="GOA:B0CE93"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE93"
FT                   /protein_id="ABW25727.1"
FT                   /translation="MKDALFMMPTARVLANVVDQLDAIEMADRDTKGDLYEYMLGKIAS
FT                   AGQNGQFRTPRHIIKLMVELTAPTPKDVICDPACGTAGFLIAASEYLMDHHSDVIYKDA
FT                   ESRRRFNEETFSGYDFDSTMLRIGSMNMLLHGVEKPDIRYKDSLAEADAAAGDDEEAYS
FT                   LILANPPFAGSLDYETTAKDLLKVVKTKKTELLFLTLFLRVLQTGGRAAVIVPDGVLFG
FT                   SSKAHKALRKMLVEDQKLDGIISMPSGVFKPYAGVSTAIVLFTKTNSGGTDQVWFYDMQ
FT                   TDGFSLDDKRTEQPDKSDLPDILTRWQAREAEAERKRTEQSFLVPREEIVENDYDLSIN
FT                   RYKEVVYEAVEYDPPGVILKRLAKLEKEIAEGQQALEKLLG"
     atgaaggatg cgctgtttat gatgccgacg gcgcgggtgt tggcgaatgt ggtggatcag        60
     ctggacgcta ttgaaatggc ggatcgcgat acgaagggcg atctatatga gtatatgctg       120
     ggcaagattg ctagtgcggg gcagaatggg cagtttcgga caccgcgcca cattattaag       180
     ctaatggtgg agttgacggc tccaacgccg aaggatgtga tttgtgatcc ggcctgtggg       240
     acggcgggct ttttgattgc ggcatcggaa tatttgatgg atcaccacag tgatgtgatt       300
     tataaggatg cggagtctcg gcgacggttt aatgaggaga cgttttccgg gtacgacttt       360
     gattcgacga tgctgcggat tggcagtatg aatatgctgc tgcacggggt agagaagcca       420
     gatattcgct ataaggattc gttggctgag gcggatgcag cggcgggtga tgatgaggaa       480
     gcctattcgt tgattctggc gaatcctccg tttgcgggga gtttggacta tgagacgacg       540
     gcgaaggatc tgttgaaggt ggtgaagacc aagaaaacag agctgttgtt tttgacgttg       600
     tttttgcggg tgttgcagac ggggggacga gcggcggtga ttgtgccgga tggggtgttg       660
     tttggttcgt caaaagccca caaagcgctg cggaagatgt tggtggaaga tcagaagctg       720
     gatgggatta tttcgatgcc gtcgggggtg tttaagccct atgcgggggt gtcgacggcg       780
     attgtgttgt ttacgaagac caattctggt gggacggatc aggtgtggtt ttatgacatg       840
     cagacagatg ggtttagctt ggatgataag cggacggagc agccggataa gagtgatttg       900
     ccggatattt tgacgcggtg gcaggctcgg gaggcggagg ctgagcggaa gcggacggag       960
     cagagctttt tggtgccgag ggaagagatt gtggagaatg attatgattt gtcgattaat      1020
     cggtataagg aggtggttta tgaggcggtg gagtatgacc cgccaggggt gattttgaag      1080
     cgattggcga agttggagaa ggagattgct gaggggcagc aggcattgga gaagttgttg      1140
     ggatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page