(data stored in ACNUC8465 zone)

EMBL: CP000828.PE638

CP000828.PE638       Location/Qualifiers
FT   CDS_pept        complement(667952..668323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0680"
FT                   /product="type I restriction-modification system, M
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25729"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE95"
FT                   /protein_id="ABW25729.1"
FT                   /translation="MITGEIKSKVDKIWDTMWSGGISNPLSVIEQLTYLLFIKQLDEQH
FT                   TRKESKANRSGKPIEEPIFAPEQDHLRWSRFKETAPEQMFETLRDEVFPFIKTLGQTDS
FT                   GENGEEDSTYSHHIPLLSL"
     atgattactg gcgagattaa atccaaagtt gacaaaatct gggacacgat gtggtcggga        60
     gggatttcta acccgctgtc ggtgattgag cagttgactt atttgctgtt tatcaagcag       120
     ttggatgagc agcatacccg caaggagagt aaagcaaatc ggtcagggaa gccgattgag       180
     gagccgattt ttgcccctga gcaggatcat ctacgctggt cacggtttaa ggaaacggcc       240
     ccggagcaga tgtttgagac cttgcgagat gaggtgtttc cgtttattaa aaccctaggc       300
     cagactgaca gcggcgagaa tggtgaggag gattctacct acagccacca tatccctctt       360
     ttatcacttt ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page