(data stored in ACNUC27125 zone)

EMBL: CP000828.PE641

CP000828.PE641       Location/Qualifiers
FT   CDS_pept        669511..669669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25732"
FT                   /db_xref="GOA:B0CE98"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE98"
FT                   /protein_id="ABW25732.1"
FT                   /translation="MASITIRNLDEDVKTKLHVQVAQNNRSMEEEARIILRQALAQAEP
FT                   NIADLAL"
     atggctagca tcactattcg aaatttagat gaggatgtca aaacaaaatt gcatgtacag        60
     gtagcccaga acaatcgctc catggaggaa gaggctcgta tcattctgcg acaggcttta       120
     gctcaagccg agcctaatat tgctgatttg gcactgtaa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page