(data stored in ACNUC8465 zone)

EMBL: CP000828.PE642

CP000828.PE642       Location/Qualifiers
FT   CDS_pept        669741..670112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0686"
FT                   /product="plasmid stability protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25733"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE99"
FT                   /protein_id="ABW25733.1"
FT                   /translation="MIILDTNVVSELMKSAPSSQVLNWMRDQDQRDLAVTVITLAEIYC
FT                   GLGRLPEGRRRANLHRRFETFIDTGFQDRLLSFEPQAAVAYGKLCNTRLQQGLHADAFD
FT                   MMIVAISQVYCCAMTKGRS"
     atgatcattc tcgatacaaa tgtggtttca gaactgatga agtcagctcc atcttcacag        60
     gtactgaact ggatgcgcga tcaagatcaa agggatctgg cggtaacggt gattaccttg       120
     gcggaaattt attgtgggtt aggtcgattg cctgagggca gaaggcgagc aaatttacat       180
     cgtagatttg aaacatttat cgatacaggt tttcaagatc gactattgag ttttgagcct       240
     caagcagctg tggcatacgg taagttgtgt aatactcgtt tgcagcaggg tttgcatgcg       300
     gatgctttcg atatgatgat tgttgcgatt tcacaggtgt attgctgtgc gatgaccaaa       360
     ggtcggtcgt ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page