(data stored in ACNUC8465 zone)

EMBL: CP000828.PE643

CP000828.PE643       Location/Qualifiers
FT   CDS_pept        670304..670516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25734"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEA0"
FT                   /protein_id="ABW25734.1"
FT                   /translation="MKRTIHFPDDLAKQMEAYLKEHPEETWSGFVQKAIQQSLHRQETS
FT                   RLRALVGILDENAPSDLSTNEDAYH"
     atgaagcgca cgattcattt tccagatgac ttagcgaagc aaatggaagc ttatctaaag        60
     gagcatcctg aagaaacatg gtcaggattt gtacaaaagg ccattcaaca atcattgcac       120
     cgccaggaaa cgtcgcgatt gcgagcactt gtgggtattt tggacgaaaa tgccccctca       180
     gatctatcca caaatgagga tgcgtatcat tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page