(data stored in ACNUC27125 zone)

EMBL: CP000828.PE644

CP000828.PE644       Location/Qualifiers
FT   CDS_pept        670517..670921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0688"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25735"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEA1"
FT                   /protein_id="ABW25735.1"
FT                   /translation="MPRLVVDAGPLIAVFHRQDTQHHYCVERLEFLIEHQYSLITTLPV
FT                   LCEVHKLIQRYASAITAQKALFELWEALDIQTLEDTGIQDAITLVVATPGWQGTLQDAS
FT                   IVVTARCLNIEVWTLDYRDFSRFQDLKLWN"
     atgcctcgac tggttgtaga tgctggccct ttgattgctg tctttcatcg acaagatact        60
     cagcaccact actgtgtgga gcgcttagag tttctgattg aacaccaata tagtttgata       120
     acgactctac ctgtcctctg tgaagtacac aagttgatcc agcgttacgc tagtgcgatc       180
     acggcccaga aagcgttatt tgaattatgg gaggctttgg acattcagac tttggaagac       240
     actggtattc aagacgccat aacgttagtg gtggctacgc caggatggca aggaacgcta       300
     caggatgcgt ctattgtggt cactgcaagg tgtttaaata ttgaagtttg gacgctagat       360
     taccgtgatt tcagtcgatt tcaggatctt aagttgtgga actaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page