(data stored in ACNUC5340 zone)

EMBL: CP000828.PE650

CP000828.PE650       Location/Qualifiers
FT   CDS_pept        complement(675785..677212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="AM1_0695"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25741"
FT                   /db_xref="GOA:B0CEA7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CEA7"
FT                   /protein_id="ABW25741.1"
FT                   /translation="MLKQQRFLLALIALLVVGALIVVTPFGKQYGLGKINLGLDLRGGS
FT                   QLTLQVNPTEEVKDITPNVMEAVQTVVANRLNPEGVSEIVVQTVGSQQILVQLPGVSDP
FT                   KDAEQLLSQVAQLDFRRPNNAILAQVNVRSSELQRLLQKLPEAEKAGDAAALAKLQGEV
FT                   QQKQKQLTELQDQFFVKTDLTGEDLNDAGYAISQSQPNKWDVTLRFDVDGGKKFAALTK
FT                   SLAGTGQPLGIFLDGKSISQATVSDRFKANGITGGAAIITGNFELEDAKLLANQLKGGS
FT                   LPVPVKVEEIRTVGATLGQDSIRQSVYAGIGGLILVLIFMGVWYRLPGLIADVALCVYG
FT                   LLTFACYVLFGVTLTLPGIAGFILSIGMAVDANILIFERTREELRSGKTLYRSIESGFY
FT                   RAFTSILDSNVTTLIACGVLYWLGSGLVRGFAVTLGIGVAVSMFTAITCSRTLMFTAIS
FT                   LPNLRKIELFDSKRAVS"
     gtgcttaaac aacaacgctt tttactagct ctcattgccc tattagtggt gggggcatta        60
     atcgtcgtca ccccgtttgg caagcagtat ggtctgggca agatcaatct gggactagac       120
     cttaggggcg ggtctcaact cacccttcag gttaacccga cggaagaagt gaaagacatc       180
     acccccaacg tgatggaagc ggtgcaaacc gtggtggcca atcgcctaaa ccctgaaggg       240
     gtttcggaaa tcgtggtcca gactgtgggt agccagcaaa ttctcgttca gcttcctggc       300
     gttagcgatc ccaaagacgc tgaacaattg cttagccaag ttgcccagct cgattttcgg       360
     cgtcccaaca atgccatctt ggcgcaagtc aatgtccgta gcagtgaact acagcgattg       420
     ttacagaagc tacccgaagc agaaaaggct ggtgatgccg ccgccctcgc aaagctccag       480
     ggagaagtcc agcagaaaca aaagcagctg actgagctac aagatcagtt ctttgtcaaa       540
     acggacttaa cgggagaaga cctcaacgat gcggggtatg ccatttccca atctcaaccg       600
     aataaatggg atgtcaccct tcggtttgat gtcgatggcg gcaaaaaatt tgcggccctc       660
     acgaaaagtc tagcgggtac gggtcagccc ttaggaattt ttctagacgg gaaatccatt       720
     agtcaagcca ccgtcagcga ccgatttaag gccaatggta ttacgggtgg tgctgccatt       780
     atcacgggca actttgagct agaagatgcc aagttattag ccaatcagct caaaggcggc       840
     tccctccccg tacccgttaa agtcgaagag attcgcaccg tgggagctac cctgggtcag       900
     gacagtatcc gtcaaagtgt ctatgccggg attggtgggc tgattctggt gctgatcttt       960
     atgggagtgt ggtaccgtct gcctggtttg atcgcagacg tagccctttg cgtttatggt      1020
     cttctcacgt ttgcctgtta tgtcttgttt ggcgttaccc tgactttgcc gggaatcgcg      1080
     ggatttatcc tcagtatcgg tatggccgtg gatgccaata tccttatttt tgagcgcact      1140
     cgggaagaat tgcggtctgg gaaaaccctc tatcgctcca tcgaatccgg attttatcgc      1200
     gccttcacta gtattctcga tagcaacgtc accacgctga ttgcctgtgg cgtgctgtat      1260
     tggttggggt cgggactggt gagaggattt gccgtcacct tgggcattgg cgttgctgtc      1320
     agtatgttta cagccattac ctgcagccgc accctgatgt ttaccgccat tagccttccc      1380
     aacctccgaa aaattgaact atttgattct aaaagggcag tctcatga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page