(data stored in ACNUC27125 zone)

EMBL: CP000828.PE653

CP000828.PE653       Location/Qualifiers
FT   CDS_pept        680053..680820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25744"
FT                   /db_xref="GOA:B0CEB0"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB0"
FT                   /protein_id="ABW25744.1"
FT                   /translation="MDTYAIFKQTQSQRVSDGAVVPLLSNCEKASLTLVLVWPQLGDFD
FT                   SLEYAWWLQRQAKQIQAKGVQIRAVGIGDLNSGQKFCDFTGFPAKHLFIDATGQLHQQL
FT                   NLYPGLTWKVPFLSPLQNAYLNLLLMCAGIGSPGTLVEVFRGYRGDRNAPQLIAEDEEV
FT                   RAFPLPPVNGALFNRAGGKGFQRPFELATLRLRNMAEVLKYWKTYVPDATYITQRGGTF
FT                   LFDQQGQLVYEHRDRGILGFAANMSNPLAFLLK"
     atggatacct acgccatttt taaacaaacg caatcccaac gagtcagtga tggtgcggtg        60
     gtgcctctct tatccaactg tgagaaggca agcttaaccc tggtcctggt ctggccgcag       120
     ctaggggatt ttgacagctt ggaatatgcc tggtggctgc agcgacaggc taagcagatt       180
     caagctaaag gcgtgcaaat tcgagcggtg ggtattggcg atctcaactc aggacagaaa       240
     ttttgtgact tcaccggatt tcctgccaag catttattca tagatgccac gggccaactc       300
     caccaacagc tcaacctgta tccaggactg acttggaagg tgccgttctt atccccgctt       360
     cagaatgcgt acctgaattt attgctgatg tgtgccggga ttggcagtcc tggaacattg       420
     gtggaagtgt ttcgaggcta tcggggagat cgcaatgccc cccaactcat tgccgaggat       480
     gaagaagtca gagcattccc tctgccgccc gtaaacggtg ccttatttaa ccgggcagga       540
     ggaaaaggat ttcagcgtcc ctttgagctg gcaacccttc gcctccgcaa tatggctgaa       600
     gtattgaagt attggaaaac ctatgtgccg gatgccacct acattaccca acggggcggt       660
     acattcctgt ttgatcaaca ggggcaattg gtgtatgagc atcgagatcg cggcatacta       720
     ggatttgccg ctaatatgag caatcccctg gcgtttctgt tgaagtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page