(data stored in ACNUC8465 zone)

EMBL: CP000828.PE656

CP000828.PE656       Location/Qualifiers
FT   CDS_pept        complement(682792..683502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0701"
FT                   /product="GUN4-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25747"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR032192"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB3"
FT                   /protein_id="ABW25747.1"
FT                   /translation="MDASAQSQPPDIAELESQLNTGSEKIQLQVMPDILAQGEAGYAIL
FT                   QNFLLSRQQEPSTFIDGRCYELLLGTEVPAVQSFLQEHFESGVVPLRSEQNIDYLPLQR
FT                   LLAKQSFQAADDLTLSKLCELSGPAAIKRKWIYFTEVEQYPIPDLQTINQLWLVHSEGK
FT                   FGYSVQRQLWLSVGRNWDVLWPKINWRSGRNWTRWPDEFTWDLSAPRGHLPLSNQLRGV
FT                   QVLNALLSHPAWTS"
     atggacgcat ctgctcaatc gcaaccgcct gatattgctg agttggagtc gcaactcaac        60
     actggctcag aaaagataca gctccaggtg atgccagaca ttttggctca gggggaagca       120
     ggttatgcca tcttgcagaa ctttttactc tctcgccagc aggaaccctc tacttttatt       180
     gatggtcgct gttatgaact gctgttagga acagaggtac cagcagtcca aagctttttg       240
     caggagcatt ttgagtcggg tgttgttccc cttcgctccg aacaaaatat tgactactta       300
     ccgctccagc gtttactagc taaacaatcc ttccaagcag ccgatgactt aaccctaagt       360
     aagctctgtg agctatcagg gccagccgcc atcaaacgaa agtggatcta tttcacggaa       420
     gttgagcaat atccgattcc tgatttgcaa accattaacc agctgtggtt agtgcattca       480
     gaagggaaat tcggctatag cgttcaacgg cagctatggc ttagtgtcgg tcgtaattgg       540
     gatgtcctct ggcccaagat taattggcgc tcggggcgga attggacccg ttggcccgat       600
     gaattcacct gggatctgag tgcgcctaga ggtcatctac ccctgtctaa ccagctgcgg       660
     ggggttcagg tgcttaatgc tttgttgtcc catccggctt ggaccagcta g                711
//

If you have problems or comments...

PBIL Back to PBIL home page