(data stored in ACNUC27125 zone)

EMBL: CP000828.PE658

CP000828.PE658       Location/Qualifiers
FT   CDS_pept        685664..686173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25749"
FT                   /db_xref="GOA:B0CEB5"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB5"
FT                   /protein_id="ABW25749.1"
FT                   /translation="MADYLIATLSDRIQAEEVHLALQEIGLSEPNLSLFGKGYKTGEDC
FT                   KDFDPALIKKRQMQRMMIFLLPLGFVGGIIFYQAVRLDVLPSLGFFANAVIGGFLGAAS
FT                   GALGGYVTGGGLSLMLDKAVPYAEQIESGTFLVVVRDAEDLKMRQANRVFRILNIDNVA
FT                   YYERPD"
     atggccgact atttgatcgc aaccttaagc gatcgcatcc aagcagaaga agtccattta        60
     gccttgcaag agatcggatt atcggaaccc aatcttagtc tgtttggcaa aggttacaag       120
     acaggcgagg actgtaaaga ctttgaccct gccttgatta agaagcggca aatgcagcgc       180
     atgatgattt ttttgctacc cctaggattt gtagggggca ttattttcta tcaggcggtc       240
     cgtttggatg tcctacctag cttgggtttt ttcgccaatg ctgtgattgg agggttcttg       300
     ggagctgctt ctggtgcatt agggggatac gtcaccggtg gtggtctatc cttgatgttg       360
     gataaagcgg ttccctatgc agagcaaatc gaatccggca cctttctggt agtggttcga       420
     gatgcagaag atctaaaaat gcgccaagcg aaccgcgttt tcagaatcct taacattgat       480
     aatgttgcct attacgagcg accagactaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page