(data stored in ACNUC27125 zone)

EMBL: CP000828.PE659

CP000828.PE659       Location/Qualifiers
FT   CDS_pept        686533..687051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25750"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB6"
FT                   /protein_id="ABW25750.1"
FT                   /translation="MHSLVNRTSIFVDGNNMFYAQQKNGWFFDPRRILNYFTEPTDVRL
FT                   INAFWYTGLKDPQDQRGFRDALISLGYTVRTKILKEYYDDSSGRYSQKANLDIEIVIDM
FT                   FNTVDQYDQVILLSGDGDFERAIELLRSKNTHITVVSTEGMIARELRNATDRYIDLNKI
FT                   RDRIEKTEP"
     atgcatagtt tggtcaatcg gacctccatc tttgtggatg gaaataatat gttttatgcc        60
     cagcagaaga atggctggtt ctttgatccc cgacgaattc taaattactt tactgaaccc       120
     acggatgttc gcttaattaa tgcgttttgg tataccggat taaaagatcc tcaagaccaa       180
     agagggttcc gagatgccct catcagttta ggctataccg tccgcacaaa aatcctcaaa       240
     gaatattacg atgattcatc tggtcgctat tcccaaaaag ccaatttaga tatcgaaatc       300
     gtcatcgata tgtttaatac ggtggaccaa tatgatcagg ttattctatt aagtggagat       360
     ggcgattttg aacgagcaat tgaattattg cgttcaaaga atacccacat aacggtggta       420
     tcgacggaag gcatgattgc ccgtgaactt cggaatgcga cggatcggta catcgatctc       480
     aacaaaattc gcgatcgcat cgaaaaaacc gaaccctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page