(data stored in ACNUC5340 zone)

EMBL: CP000828.PE66

CP000828.PE66        Location/Qualifiers
FT   CDS_pept        70390..71421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0069"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25157"
FT                   /db_xref="GOA:B0C545"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0C545"
FT                   /protein_id="ABW25157.1"
FT                   /translation="MPDSPKPSNILIVDDVPTNLTILAQTLRDQGFTVWVATSGNAALK
FT                   QLAHGLPDLILLDIQMPGMNGLETCAKLKADLRTQDIPVIFMSALSEQANKVEGLSLGA
FT                   VDYITKPFQEAEVLARVKVHLSIRELTQNLQREIEERKRVEAELAKANASLHRLAHIDG
FT                   LTQVANRYRFDQDMEQVWRRLQRDHEPLSLILCDVDYFKLFNDHYGHQVGDDCLRQVAL
FT                   AIQKAVHRPDDLVARYGGEEFAIVLPSTHAQGAEQVALGILSKIAELNIPHEFSTVSPQ
FT                   ITLSLGIATVIPKSEQSLDGLIELTDKALYRAKEEGRNTYCHHDCSQSPPSLSCSPSPL
FT                   SLH"
     atgcctgatt cccccaaacc ttcaaatatt ctcatcgtcg atgatgtgcc aacgaatctc        60
     accattttgg ctcagacact cagagatcag gggtttacag tttgggtcgc cactagtggg       120
     aatgctgcct taaagcagtt agctcatggt ttacctgatc tgattttgtt agatatccaa       180
     atgccgggaa tgaatggctt ggaaacttgt gcaaaattaa aagccgatct tcgtacccag       240
     gatattcccg ttattttcat gtctgctcta agtgagcagg cgaataaagt tgagggattg       300
     tccttaggag cggttgatta catcaccaag cctttccagg aagccgaagt cctcgccaga       360
     gtgaaagtgc atttgagcat tcgagagctg acgcagaatc tgcagcggga aattgaagag       420
     cgtaaacgag ttgaagcaga actcgcaaag gcaaatgcct ctttgcatcg cctagcccac       480
     attgatggct taactcaagt ggccaaccgc tatcggtttg atcaagatat ggagcaagtt       540
     tggcggcgat tacaacgtga tcatgaaccc ttatcgctca ttttatgcga cgttgattat       600
     ttcaaattgt ttaacgatca ctatggtcat caggttggag atgactgctt aaggcaagtc       660
     gcccttgcca tccaaaaggc cgttcatcgc ccggacgatc tggttgctcg ctatgggggc       720
     gaagaatttg cgatcgtttt gccttcaacc catgcccaag gcgcagaaca agttgccctg       780
     ggcattctca gtaagattgc agaactcaac attccccatg agttttccac tgttagccct       840
     caaatcaccc taagtttagg aattgccacc gttattccta aatctgagca gtcgttggat       900
     ggcttaattg aattaacaga caaagcgcta tatcgggcta aggaagaagg tagaaatact       960
     tattgtcacc atgactgttc acaatcccct ccctctctaa gctgctcgcc atctccccta      1020
     tccctccatt ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page