(data stored in ACNUC27125 zone)

EMBL: CP000828.PE661

CP000828.PE661       Location/Qualifiers
FT   CDS_pept        688888..689388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0706"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25752"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB8"
FT                   /protein_id="ABW25752.1"
FT                   /translation="MTPDQPTPSSPEPARSLDALMHERDQAQASAKRWRRLYEVEAQQR
FT                   QKESDEAEQTIQVLRAEVQRLCQFSGGAPMLMPSPGKSKGGSSGHSQSQVADLMAERDQ
FT                   LLQALEQEKQSHEKTKQNLISALGDALGAQRRKSLALPSSRAGARAGAIILKDRDGRRS
FT                   KPD"
     atgacccctg atcaacctac tccttctagt cctgagcctg ctcgatcatt agatgccctg        60
     atgcatgagc gagatcaggc tcaggcgagt gcaaagcgct ggcgtcgttt atatgaagtt       120
     gaggcacaac agcgtcagaa agaatcggac gaggcagagc aaacaatcca agttttgaga       180
     gcagaggttc agcgtttgtg ccagttttca ggcggtgcac caatgctgat gccttcgcca       240
     ggtaagtcta aggggggatc tagtgggcat tcacagagcc aagtggctga tttgatggct       300
     gaacgagatc agctattaca agctttggag caagaaaagc aaagccacga gaagacgaag       360
     caaaacttga ttagtgcgtt gggtgatgcg ttgggtgcac aaagacgaaa gtctctagct       420
     ttaccctcat cacgagccgg tgcaagggca ggggccatta ttctcaaaga tcgagatggg       480
     cgaagatcta aacctgacta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page