(data stored in ACNUC5340 zone)

EMBL: CP000828.PE667

CP000828.PE667       Location/Qualifiers
FT   CDS_pept        693191..693598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25758"
FT                   /db_xref="GOA:B0CEC4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEC4"
FT                   /protein_id="ABW25758.1"
FT                   /translation="MFYGLALAFGLIHVSNFTSLGVQALLLAPLLVLPQIVIGVFLGFI
FT                   RLQYGFWWAVLTHGFHNACAITPLLLVRLGSENLLERMGNGIQENSLVGTDYVLILLMA
FT                   TYVLGGLLLCLITVWKLIAEWRREQQVNSSS"
     ttgttttatg gtttggctct ggcttttggt ctcattcatg tgagtaactt cacgagtttg        60
     ggggttcagg ccttgctttt agctcccctt ttggttttgc cccaaatcgt gattggggtg       120
     tttttgggat ttattcgatt gcagtatggg ttttggtggg cggtgttgac ccatggtttc       180
     cacaatgctt gtgccataac accgctgcta ctggtacgtt tggggtcaga gaatttgctt       240
     gagaggatgg gcaatggtat ccaagagaac tccttagtgg gaacagacta tgtgctcata       300
     ttgctgatgg cgacctacgt actcggtggt ctattacttt gtttaattac agtgtggaag       360
     ttaatcgcag aatggcgacg ggaacagcag gtgaactcca gttcctag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page