(data stored in ACNUC27125 zone)

EMBL: CP000828.PE668

CP000828.PE668       Location/Qualifiers
FT   CDS_pept        complement(693681..694838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25759"
FT                   /db_xref="GOA:B0CEC5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEC5"
FT                   /protein_id="ABW25759.1"
FT                   /translation="MVQHMNSVELLVDADAFWHRLQNDLQAADHEIMLQMMTFEGDRTG
FT                   QQVIEAMLASEAPCKQILVDNYTRFIQSDKFIYHPKYWSDQDLKTEVRQTHAMFEALIQ
FT                   EGGQVRFTNPVGPFLIHFVGRSHKKLIVIDNQIAYIGGFNFSDHNFAWHDLMFRLEDPA
FT                   IVEFLRADFMATWQDQSQPSHADFGDCEFFLLNGRTNEATFAILLDLLCSAQKSLHIIS
FT                   PYLTFPFCAALAELPQRGVPVTLLTPEGNNKGTVRDYLLWEAQRSGFDVRLYDGMSHMK
FT                   AALVDDRYLVVGSSNFDFLSYRIEEEVLAIFSNPTVIETFRQQVLEPDLARCRPFDGQA
FT                   SALRGWLSYGILRAVETLALFSRRIKSTQVIDTAVRGYPVMPKES"
     ttggttcagc atatgaattc tgtggagctt cttgttgatg cagatgcctt ttggcatcgt        60
     ctccagaacg atctacaagc ggctgatcac gaaattatgc tccagatgat gacctttgaa       120
     ggtgaccgaa ccggccagca agtaatcgag gccatgctgg catctgaagc gccttgcaaa       180
     cagatcctgg tcgataacta cacgcgattt attcagagtg acaagtttat ctaccatccc       240
     aaatattggt cagatcaaga cctcaaaact gaagtccgcc agacccacgc tatgtttgaa       300
     gcccttatcc aggagggggg gcaggtccga tttacgaatc ctgtcgggcc cttcttgatt       360
     cattttgtag ggcgtagcca taaaaagctg atcgtaattg acaaccagat tgcctacatt       420
     ggtggtttta acttcagcga ccataacttt gcttggcatg acctgatgtt tcggttagaa       480
     gacccagcca ttgtggaatt cctgcgggca gattttatgg ccacttggca agatcaatct       540
     caacccagcc acgctgactt cggggactgc gagttttttc tcctgaatgg ccgaacgaat       600
     gaagcgacat ttgcaatctt gctagatctg ctgtgctctg ctcagaaatc tctgcatatt       660
     attagtccct atctcacctt ccccttctgt gctgccttgg ctgaactccc tcagcggggg       720
     gtacccgtca ctctactcac cccagaaggc aacaacaaag gcactgtccg agattatctg       780
     ttgtgggagg cccaacggtc cgggtttgac gttcgtctct acgacggcat gagccatatg       840
     aaagcagctc tagtggacga tcgctatctg gtggtgggtt cgtctaattt tgattttttg       900
     agctatcgca ttgaagaaga agtcctggcc attttttcta atcccactgt aattgagacg       960
     tttcgccaac aggtcctaga acccgatctg gctcgctgcc gtccttttga tggccaagcc      1020
     agtgctctgc gaggctggct ctcctatggc attctgcgag ccgtagaaac cttggctctc      1080
     ttctctcgcc ggattaaatc cacccaagtg attgataccg ccgtgcgggg ttaccctgtg      1140
     atgccgaagg aatcctag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page