(data stored in ACNUC8465 zone)

EMBL: CP000828.PE67

CP000828.PE67        Location/Qualifiers
FT   CDS_pept        71535..71972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25158"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B0C546"
FT                   /protein_id="ABW25158.1"
FT                   /translation="MVIVHEILDLETDQGIGIYNLSPQIQEFIAASSIRNGQVLICSRH
FT                   TTTSLAINEYEERLLEDIKVYLHKLAPANQRYLHNDLHLRDVPEDEPENAHSHLMAITL
FT                   SSSEVAPIVEGQLALGTYQSVLLFELDGPRQRTVFLQLSGE"
     atggtgattg tgcatgaaat tcttgatctt gaaaccgatc aagggattgg catttataat        60
     ctttcccctc aaattcaaga gtttattgct gctagctcaa ttcgaaatgg ccaagtttta       120
     atctgttctc ggcataccac tacgtcttta gccattaacg agtatgaaga acgattatta       180
     gaggacatta aagtctattt gcacaagctg gctccagcga accaacgata cctgcataat       240
     gatctacatt tgcgggatgt ccccgaagat gagccagaaa atgcgcattc tcacctgatg       300
     gcgatcacgc tttcttccag tgaagtggcg cctattgtcg agggccaatt agctttaggg       360
     acttatcaat cggtcctgtt gtttgagctg gatggccctc gacaaagaac ggtctttctt       420
     caactatctg gagagtag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page