(data stored in ACNUC27125 zone)

EMBL: CP000828.PE671

CP000828.PE671       Location/Qualifiers
FT   CDS_pept        698923..701268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0716"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25762"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEC8"
FT                   /protein_id="ABW25762.1"
FT                   /translation="MFTSGGTVQAGDGIYLERKADQELLALCQAGNFVYILTPRQMGKS
FT                   SLMVRTAQTLASQGIQSVIIDLTQIGTELAAEQWYLGFLTLIEEQLDLETDVEAWWESK
FT                   AKLGVTQRLTQFFQTVLLKEIDKPVVLFVDEIDTTLGLEFTDDLFTAIRFLYVARAHQP
FT                   EMKRLSVVLIGVATPGDLIRDARRTPFNIGHRVDLTDFTVEEAMPLAAGFGLSEEKAQR
FT                   LLGKVLAWTGGHPYLTQRLCESLVNEWSGSLGEADVDRAVGQTFLGERSEQENNLQFVR
FT                   DMLTKRAPEPKKLVLETYRQIHRDKVAVADEEQSLVKSHLKLAGVVQLEGHHLKVRNPV
FT                   YREVFDSQWIQDHWPETRWQRLKPALPYIAGLSAVLFGVTGLAVYAIDQSDKALKAEAI
FT                   AEQKAKETEVALEQSRKNETAAEAAAREAQRQKKLAQTSASLARRRLQQVNTARKREVL
FT                   EREKAQKAQKLAERRQREAEAQKSIAIEQRAVAEQQRIAAEQATAREKEQTIVARKATQ
FT                   RAETQAKLATLKEQAASGLYWLSATNPTFGFVLAIDTMNQSQSISDVEVVAQSVLLKSI
FT                   QRVQEIKLLQGHQAAVLSVSYSPDGTRIVSGSLDNTVRIWDAKTGQPIGEPLQGHQNTV
FT                   WSVSYSPDGRRIVSGSSDNTVRIWDAKTGQAIGEPLQGHQNDVYSVSFSPDGTRIVSGS
FT                   RDKTVRIWEVGPESLTRLACDRFRLHPLLHQPEKVTSDPSIIEAAIRSKAVCKQHFPAW
FT                   DSYRASQPGFPKWLFSRFQQLLADWLNT"
     atgtttacct ccgggggaac ggtccaagct ggagatggca tttatctaga acgcaaggcg        60
     gatcaagaat tactggctct ctgtcaggca gggaactttg tttatatcct tacccctcga       120
     cagatgggga aatcgagctt aatggtgcga acggctcaaa ccttagccag tcagggcatt       180
     caatcggtaa ttattgactt gacccagatt ggcacagagt tggcggcgga gcagtggtat       240
     ctgggattcc taacgctgat cgaagaacag ctagatctag agacggatgt agaggcgtgg       300
     tgggagtcga aagcaaagtt aggggtgacc caacgactca cgcagttttt tcaaacggtt       360
     ctgctcaagg agatagacaa acccgtcgtt ctctttgtgg atgaaattga tacgacattg       420
     ggactggagt ttacggatga tctatttacc gcgattcgtt ttctctacgt cgctcgggct       480
     caccaaccgg aaatgaagcg gctctcagtg gtgttgattg gggtggcgac gccaggggat       540
     ttgattcgag atgcgagaag aacgccgttt aatattggcc atcgggtgga tttaacggat       600
     ttcaccgttg aggaggcaat gcccttagcg gctggatttg gcctatcgga agaaaaggcg       660
     caaagactgt tgggcaaggt gttggcttgg acgggggggc atccctatct gactcagcga       720
     ctttgtgagt ctttggtgaa tgagtggtct ggctccttag gggaagctga tgtagataga       780
     gccgtgggcc aaactttttt gggggagcga agcgaacagg agaataacct gcagtttgtc       840
     cgggatatgc tgaccaaacg ggcccctgag ccaaagaagt tggtgttaga aacctatcgg       900
     caaatccatc gggacaaggt ggcggtcgca gatgaggagc aatctttagt taagtctcat       960
     cttaagctgg caggtgtggt gcagttggaa gggcaccacc tgaaggttcg gaatccggtt      1020
     taccgagaag tctttgattc ccaatggatt caggaccatt ggcccgagac gcgttggcag      1080
     cggttaaagc cagcattacc ctatatagct ggtttatccg ctgttttatt tggcgttacg      1140
     ggattggctg tttatgccat tgatcaaagt gataaagcct taaaggctga agcaatagct      1200
     gagcagaagg ctaaagaaac tgaagttgct cttgaacaat ctcgcaaaaa tgaaacagct      1260
     gcagaagctg ccgcccgtga ggcgcaaaga caaaagaaac tggcgcaaac atcggcatcc      1320
     ctggcaaggc gacggttgca gcaagtgaat actgcccgca agagggaagt cctagaaagg      1380
     gaaaaggctc aaaaagccca gaagctggca gaacgccgac agagggaagc ggaagcccag      1440
     aaaagcattg cgattgagca aagagcagtt gcagaacagc aaagaattgc tgctgaacag      1500
     gcaacggcaa gagaaaaaga acaaaccata gttgcacgaa aggctacgca acgcgcagaa      1560
     acgcaagcca agttagctac tttgaaagaa caggccgctt caggtttgta ttggctttct      1620
     gcgacgaatc ctacttttgg ttttgtatta gccattgaca caatgaatca gagtcaatct      1680
     atttctgatg ttgaggtagt tgcccaatcg gttctcctta aatcgatcca acgggtacaa      1740
     gaaataaagc tgctgcaagg ccaccaggct gctgtcttgt cggtgtccta tagcccggat      1800
     ggaacgcgca tcgtcagtgg gagtttggac aataccgtgc gcatttggga tgccaagacc      1860
     gggcaaccca tcggagagcc cctccaaggc caccagaata ctgtctggtc ggtgtcctat      1920
     agcccggatg gaaggcgcat cgtcagtggg agtagtgaca ataccgtgcg catttgggat      1980
     gccaagaccg ggcaagcgat cggagagccc ctccaaggcc accagaatga tgtctattcg      2040
     gtgtccttta gcccggatgg aacgcgcatt gtcagtggga gtagggacaa gaccgtgcgc      2100
     atttgggaag ttggccctga gtctttaact cgattagctt gtgatcggtt caggttgcat      2160
     cccttacttc atcagcctga gaaagttact tcagatccat ctattattga ggcagccatc      2220
     cgttccaagg cggtttgcaa acaacatttc cctgcttggg attcctaccg agcatcccaa      2280
     cccggattcc ctaaatggct attcagtcgt ttccaacaac ttttggccga ttggctcaac      2340
     acttaa                                                                 2346
//

If you have problems or comments...

PBIL Back to PBIL home page