(data stored in ACNUC27125 zone)

EMBL: CP000828.PE672

CP000828.PE672       Location/Qualifiers
FT   CDS_pept        complement(701505..701681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25763"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEC9"
FT                   /protein_id="ABW25763.1"
FT                   /translation="MIELDGDIHNRLKYDEARTEQLHQLGFRLIRFHNSDVMHHLDHVL
FT                   QQIRYASEQSTDR"
     gtgattgagc tagacggcga catccacaat cggctgaagt atgatgaagc ccgtaccgag        60
     cagctccacc agcttggttt tcgattgatc cgctttcata actcagacgt tatgcaccac       120
     ctagatcatg tacttcagca aatccgatat gcgagtgagc aaagcactga tcgatag          177
//

If you have problems or comments...

PBIL Back to PBIL home page