(data stored in ACNUC5340 zone)

EMBL: CP000828.PE674

CP000828.PE674       Location/Qualifiers
FT   CDS_pept        complement(702061..703074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0719"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25765"
FT                   /db_xref="GOA:B0CED1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B0CED1"
FT                   /protein_id="ABW25765.1"
FT                   /translation="MNKFWHKKTFVRLLMLFCVGLGLTFLFQKINLQGRDLLEAFQRFS
FT                   PEALVLMLGVTLVQMVFQVTRLWVLCPQAAGVSWAQAANTYVSGQFIGNFVLSQAGHAV
FT                   KIALLRKDKDAKGRKIDAAEATAVILVDKVLDVGILVTLAVLSALQVSVGLPQVDWWEK
FT                   GIIVLIGVPFLGIALWALQRSLRQRFPKLRQWLRKFKVGLAVIRNPLQIRNAAVMDLGD
FT                   WFTECLLLQLLCMAQGHVLSLPQLLICLFILNLGLTVPTTMANLGTYEAALAFSLNGMG
FT                   VPLAQSVVIATMFHAYQLFGLPVWMFIQKLSVRFSPKLNSAVPIPVTPERSKVTSK"
     atgaataagt tttggcataa gaaaacgttt gtccgtctct taatgctgtt ttgcgttgga        60
     ctcggactca cttttctctt tcaaaaaatc aatctccaag gccgtgattt gctagaagcc       120
     tttcagcggt ttagtcccga agcgcttgtg ctaatgctag gggttacctt ggtgcaaatg       180
     gtgtttcagg taactcgttt atgggtgctt tgtccccaag cggctggggt gagttgggca       240
     caagcagcga atacctacgt gtcgggacag tttattggca atttcgtgct gagccaagct       300
     ggacatgccg tcaaaattgc cctgttgcgc aaggataaag atgcgaaggg ccgcaagatt       360
     gatgcggctg aagccacggc ggttatttta gtggataagg tgctggatgt gggcatcttg       420
     gtcactttgg cagtgctatc ggccttacaa gtttctgttg gtctacccca ggttgattgg       480
     tgggagaaag gcattattgt tctgatcggc gttccttttc tggggatagc cctgtgggca       540
     cttcaacgaa gtttgcgcca acggttccca aagctacggc agtggcttcg taagtttaag       600
     gtcggactgg cggtgattcg taatcctctc caaattcgca atgctgcggt catggatttg       660
     ggggattggt ttacggaatg tctgctgcta cagctattgt gtatggctca aggccatgtt       720
     ctgtctttac cgcagctttt aatttgtcta tttattctga atttggggct gacggtgcca       780
     accacgatgg caaacttggg cacctatgaa gcggccttgg cgttttctct gaatggtatg       840
     ggggttcctt tggcacaaag cgtcgtaatt gccacgatgt ttcatgctta ccaactgttt       900
     ggattgccgg tgtggatgtt tatccaaaaa ttgagtgttc gcttctcacc taagttgaat       960
     tctgcggtgc ctattcccgt tactccagag cgctctaagg ttacttccaa gtaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page