(data stored in ACNUC5340 zone)

EMBL: CP000828.PE680

CP000828.PE680       Location/Qualifiers
FT   CDS_pept        710419..710874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0725"
FT                   /product="phosphopantetheine attachment site protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25771"
FT                   /db_xref="GOA:B0CF84"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF84"
FT                   /protein_id="ABW25771.1"
FT                   /translation="MPIQDNYQSTVAVAEAQPQGAVSPLETSPKLADIQAWLKKHLATS
FT                   LEMSPEEIDIDVDFIDYGMNSVEVVNISGELEHFLGRRLDPMLVLDYSNIRELSEHLVT
FT                   DNEGSSPTTSALPTEADELLSKLDVLSDDEVDGLLNAMLSEHNVAHE"
     atgccaatcc aggataacta tcaaagcacg gtcgctgtgg cggaagcaca gcctcagggc        60
     gctgtttcgc ccttggagac ttcccctaaa ctagcagata ttcaagcctg gttaaaaaaa       120
     cacttggcaa cttctttgga aatgagtcca gaggaaattg atatcgatgt ggatttcatt       180
     gattacggaa tgaactccgt agaagtcgtc aatatttccg gtgaactaga acattttctg       240
     ggtcgccgtt tggatcccat gctggtttta gattattcca atattcgtga attatcagag       300
     cacctagtaa ccgataatga aggcagttct cccactactt cagcattacc cacagaagcc       360
     gatgaactcc tatccaaatt ggatgtactg agtgacgatg aagtggatgg tctgctgaac       420
     gcgatgttgt cagagcataa tgttgcccat gagtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page