(data stored in ACNUC27125 zone)

EMBL: CP000828.PE686

CP000828.PE686       Location/Qualifiers
FT   CDS_pept        complement(716055..716495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25777"
FT                   /db_xref="GOA:B0CF90"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF90"
FT                   /protein_id="ABW25777.1"
FT                   /translation="MIWLLDNPFIQYKLGNMAPTKPKPPVQVIDSFLTQQDILSALVVW
FT                   VILEGFSFILLPNFTLISGENKTLTWVLISAPLGIIGSIIIGLCSSWLQYCHVRLHKTD
FT                   PKKKFLVAFANIGSWLGLAGIGFPLIMVGLEFWLLIIHGIDS"
     atgatttggc tacttgacaa tccttttatc caatacaaac tagggaatat ggctccaact        60
     aaaccaaagc cccccgttca agtaattgat tcttttctca ctcagcagga tattttgagt       120
     gccttagtag tttgggtgat tctcgaagga tttagcttta ttctcttgcc caacttcaca       180
     ctgatcagtg gggaaaataa aaccctgact tgggttttga taagtgctcc tttaggaatt       240
     attggatcta tcatcatcgg tctttgctct agctggttgc aatactgcca tgtgcgattg       300
     cataaaaccg atcctaaaaa aaagtttttg gttgcctttg cgaatattgg gagttggctt       360
     ggtttggccg gaattggatt tcccttgata atggtgggcc tagaattctg gttgctgata       420
     attcatggta ttgatagcta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page