(data stored in ACNUC5340 zone)

EMBL: CP000828.PE687

CP000828.PE687       Location/Qualifiers
FT   CDS_pept        716590..716874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0732"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25778"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF91"
FT                   /protein_id="ABW25778.1"
FT                   /translation="MAQAVWNGVVVAESNQCEVVEGNQYFPPDAIKSDYFKASDTHTTC
FT                   PWKGVASYYSLEVDGQVNKDAAWYYPDPKDAAKNIKGYIAFWKGVQVTA"
     atggcacaag cagtttggaa tggtgtggtt gtggctgaaa gcaaccaatg cgaagtggta        60
     gaagggaatc aatacttccc acccgatgcc attaaatctg actatttcaa ggccagcgac       120
     acccatacga cctgcccttg gaaaggtgtt gctagctatt acagtcttga agtggacggt       180
     caggtcaaca aagatgccgc ttggtattat cctgacccca aagatgccgc taagaatatt       240
     aaggggtaca ttgctttttg gaaaggcgtg caggtgacgg cctaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page