(data stored in ACNUC27125 zone)

EMBL: CP000828.PE691

CP000828.PE691       Location/Qualifiers
FT   CDS_pept        717708..717824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25782"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF95"
FT                   /protein_id="ABW25782.1"
FT                   /translation="MEGETDIICRGIKFLHLQFTQDLRIDINSVDRKGREMS"
     atggaaggcg aaactgacat catttgtcgc ggaatcaaat tcttgcacct tcaattcact        60
     caggacttac gcattgacat aaactcagta gatcgtaaag gtcgagaaat gtcgtaa          117
//

If you have problems or comments...

PBIL Back to PBIL home page