(data stored in ACNUC8465 zone)

EMBL: CP000828.PE694

CP000828.PE694       Location/Qualifiers
FT   CDS_pept        complement(719675..719980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25785"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF98"
FT                   /protein_id="ABW25785.1"
FT                   /translation="MSIADGVSLFQVTVDAPSRVGIKTLSHGGGRLADGPGPDISPGGF
FT                   DPILTLFDSNNTFIAENDAREGRSDPTTGSAYDSRIVRSLTPGTYESCSEPIQQFL"
     ttgagcatcg ctgatggcgt ttccctcttt caggttacgg tggatgcgcc ttcaagagta        60
     ggaattaaga ccctctctca cgggggtggg cgtttagcag atggaccagg accagatatt       120
     tcaccaggtg gatttgaccc catcttgacc ttgtttgata gcaacaatac ttttattgct       180
     gaaaacgatg ctcgagaagg caggagtgac ccgacaacag gttcagccta tgattctcgc       240
     attgtccgat ccctgactcc cggcacatat gaaagttgca gtgagccaat tcaacaattt       300
     ctataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page