(data stored in ACNUC8465 zone)

EMBL: CP000828.PE7

CP000828.PE7         Location/Qualifiers
FT   CDS_pept        complement(8126..8617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0009"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25098"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Y6"
FT                   /protein_id="ABW25098.1"
FT                   /translation="MAESHPVVKDFMTPDPITISPTDSIERVIKLIEDHRISGMPVVDA
FT                   SNHVVGIISEGDLLVRESPMQPPLYMTLLGSVIYFESPKQFHQHMQKALGMLVQDVMTS
FT                   QPITTKPDIPLTSAANLMLSKKINRLPVVDNDQYLIGIITRHDLVRALKPAVTYESLPD
FT                   "
     atggcagaat ctcatcccgt agtcaaagac tttatgaccc ctgatcctat tactatctct        60
     cccacggact caatagagag agtgatcaag ctcatagagg atcatcgaat cagtggaatg       120
     ccggtggtgg atgcctcgaa tcatgttgtt ggcattatct cagaaggcga tttgctcgtt       180
     agagaatccc ccatgcaacc tcctttgtat atgacattgc tagggagcgt catatacttt       240
     gagtctccga agcaattcca tcagcatatg caaaaggcgt tgggtatgtt ggttcaggac       300
     gttatgacga gccaaccgat taccactaag ccagatatcc ccttaacgtc tgcagccaac       360
     ttgatgttgt ctaaaaagat caaccgttta ccagtggttg ataacgacca atatttgata       420
     ggcatcatta cacggcatga tttagtgcgc gcattaaagc ctgccgtaac ctatgaatca       480
     cttcctgatt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page