(data stored in ACNUC27125 zone)

EMBL: CP000828.PE701

CP000828.PE701       Location/Qualifiers
FT   CDS_pept        726429..727070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0748"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25792"
FT                   /db_xref="GOA:B0CFA5"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFA5"
FT                   /protein_id="ABW25792.1"
FT                   /translation="MLTLYWSCFLIGGVFVFLAVIGGIDGVEFELDELGLDSDVEIFDQ
FT                   RSRSSSTFDSISKKRRKFPLLGLFRSLKFWTFGSCFFGLTGILLSALQTGMPALAITLI
FT                   AMAMGLFFGTAMSGLLLYLRHQQTDSLISHDDLVGLAGTVEIPFDAQSRGKVRLKVKGS
FT                   ILEVVAFTDGNRSFQPGEQVVVVGTQENRVWVVSSDSFNQPPDALSSGQT"
     atgctgaccc tgtattggtc ttgttttctg atcggtggtg tttttgtttt tctagctgtt        60
     attggtggta ttgatggagt tgagtttgaa ctagatgagt tgggactaga ctcagatgta       120
     gaaatctttg atcaaagatc tcgttcctca tcaaccttcg attccatctc taagaaacgc       180
     cgaaagttcc ccttactagg tctgtttaga agcctcaaat tctggacctt tggcagttgt       240
     ttttttggcc taaccggcat tctgctgagt gcattacaaa ccgggatgcc agctctagcc       300
     attacgctga tcgccatggc aatgggcctg ttctttggaa cggccatgtc cgggttactc       360
     ctgtacctcc gacatcagca gacggatagc ctaattagcc atgatgattt ggtgggatta       420
     gcaggcacag ttgaaatccc ttttgatgcc caatcccgag gcaaagttcg cttaaaagta       480
     aagggcagca tcctggaagt tgtggccttt accgatggca atcgttcctt tcagcccggc       540
     gagcaagtgg tcgtcgtggg tacccaagag aacagagttt gggtcgtctc tagtgattcg       600
     tttaatcagc cgccagatgc gttgagcagc ggccaaacct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page