(data stored in ACNUC27125 zone)

EMBL: CP000828.PE708

CP000828.PE708       Location/Qualifiers
FT   CDS_pept        735554..736327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0755"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25799"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFB2"
FT                   /protein_id="ABW25799.1"
FT                   /translation="MPIPDPFAHLDTVSLTPIAYIRSCYPERFGIPRQAGLVESAKAAI
FT                   VFPNTDLHWHSLRGIESFSHIWVIFLLHGQSFTKFRPLVRPPRLGGNKSMGVYATRSPN
FT                   RPNQIGLSAVPLDQVEQTSEEILLHIHGGDFLDGTPVLDIKPYVPYADAIPSATSAWAD
FT                   DADPLLPVVWSPEAMASLTSALTRDFQETQQVISEVIAQDPRPGYERRKDGQAGQEWNM
FT                   RLAGLDIFWKVEAGTAIVTRLFPVSSSDPIPKPQP"
     atgccgattc ctgatccctt tgcccacttg gatacagtat ctttaacccc gattgcctac        60
     attcgatctt gttaccctga acgatttggc attccccgac aggcaggctt ggtggagtct       120
     gccaaagcag ccattgtctt tcccaacacg gatttgcatt ggcattcatt gcgagggata       180
     gagagctttt cccacatctg ggtgatcttt ttgctgcatg gtcaatcctt taccaagttt       240
     cgtcccctgg tgcgtccccc ccgtttgggt ggaaataaaa gcatgggagt ttatgcaact       300
     cgcagcccca atcgtccgaa tcaaattgga ttaagcgcag tgcctttaga tcaagttgag       360
     cagacctcag aggaaattct gctccatatt catggcggag acttcttaga tggcacaccc       420
     gtgttagata tcaaacccta tgtaccctat gcagatgcaa tcccatctgc aaccagtgct       480
     tgggctgatg atgcggatcc acttttgccg gtggtatgga gtcccgaagc aatggccagc       540
     ctgacctcag ctttaactcg tgattttcag gaaacccaac aggtaatttc agaggtgatt       600
     gcccaagatc ctcgtccagg ctatgagcgc aggaaagatg gtcaggcggg gcaagagtgg       660
     aatatgcgcc tagctgggtt agatattttt tggaaagtag aagcaggaac agcgattgtt       720
     actcgactct ttcctgtatc cagttctgac cctatcccta aacctcagcc ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page