(data stored in ACNUC8465 zone)

EMBL: CP000828.PE711

CP000828.PE711       Location/Qualifiers
FT   CDS_pept        complement(738497..738904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25802"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFB5"
FT                   /protein_id="ABW25802.1"
FT                   /translation="MKNVRALTQKAFAGLAALAVGFSATTAMADPTQRKIITQGSHGAS
FT                   KIVKVAATQNPVARQLSPFNLAYMAYQGWFTEEGVPAASRLIRDYRIGRITAVDVAQAA
FT                   VKTNRLSAETLQDSSYLASLDNQLEGLSQPD"
     atgaaaaacg ttagagcttt aactcagaag gcatttgctg gccttgcagc tttggctgtt        60
     ggatttagcg caaccactgc aatggctgac cccacccagc gaaaaattat tacccaaggt       120
     tcccacggtg caagcaaaat tgtgaaagtc gctgccaccc aaaatccagt agcgcgccaa       180
     ttatctccct tcaacttggc atatatggca taccaaggtt ggtttacgga ggaaggtgtg       240
     cctgcagcga gtcggttgat tcgagattat cggattggac gaattaccgc tgtagatgtg       300
     gcccaggctg cagtcaaaac gaatcgcctc tctgctgaaa cccttcaaga ttccagctat       360
     ctggccagtt tggataatca actagaaggg ctgagccaac ccgattaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page