(data stored in ACNUC27125 zone)

EMBL: CP000828.PE713

CP000828.PE713       Location/Qualifiers
FT   CDS_pept        740104..740310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25804"
FT                   /db_xref="GOA:B0CFB7"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFB7"
FT                   /protein_id="ABW25804.1"
FT                   /translation="MNGQHDWAKYWLSCCDDPESFFEQYGWQTSAIQPGDEGASFGRFT
FT                   CQFSDPSLIDKPHLYFIAACRQE"
     atgaacggcc agcatgactg ggctaagtat tggctgtcct gttgtgatga tccagagtct        60
     ttctttgaac agtatggttg gcagacctca gcgattcaac caggtgatga gggtgcttcg       120
     tttggccgct tcacatgcca gttttcagat cctagtctta ttgataagcc tcatctgtat       180
     tttatagctg cctgtaggca agagtag                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page