(data stored in ACNUC27125 zone)

EMBL: CP000828.PE718

CP000828.PE718       Location/Qualifiers
FT   CDS_pept        complement(742398..743597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0765"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25809"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFC2"
FT                   /protein_id="ABW25809.1"
FT                   /translation="MSTPLSWSELADRTDFHLDPVNGPTNAQSCLRLFGQSEDDVKVTL
FT                   FRDNHAWCPYCQKIWLWLEEKQIPYRIEKVTMFCYGEKERWYKQIVPSGMLPALELKGQ
FT                   VITESDDILIALEKEFGPLGKGMQDPAVMPLRQLERLLFRAWCTWLCYPSRPRQDQRNR
FT                   EQFVSVVKKVEAALSQTPGPYFLEEFGTADAIFTPYVERMNASLYYYKGYSLREENPRF
FT                   SDWFDAMESRPTYRGTQSDFHTHAHDLPPQMGGCYKNNDPQTPINMSRVDNGPWSELPD
FT                   VTYPEPETSRAEALHRVVKHHENIIKVNPTKDELIDEALRCALTHLITGEVCTPPSGSD
FT                   LGLRYLRDRISVPRDMSIYAAKRLKESLEATAALVGNRQGTPIPVRHRRDQDPTNFAKA
FT                   "
     atgagtactc ccctgagctg gtctgaatta gctgaccgta ctgacttcca tttggatcct        60
     gtgaacggtc caaccaatgc ccaatcctgt ctgcgtttgt ttggtcaatc cgaagacgat       120
     gtaaaggtta cactcttccg tgacaatcac gcctggtgtc cctactgcca aaaaatttgg       180
     ctatggctag aagagaagca gatcccctat cggatcgaaa aagtgacgat gttttgttac       240
     ggggaaaaag agcgatggta taagcagata gtaccctcgg ggatgttgcc cgctctagag       300
     ctaaagggtc aggtgatcac cgagagtgat gatatcttaa ttgccttaga aaaagagttt       360
     ggtcctctag gcaaaggtat gcaagacccg gcagttatgc ctttgcgcca actggagcga       420
     ttactgtttc gggcctggtg tacttggttg tgctatccct cccgtcctcg acaagatcag       480
     cggaatcgag agcagtttgt cagcgtggta aaaaaggtcg aagctgctct aagccaaacc       540
     cctggacctt actttttgga agaatttggc actgcagacg caatttttac cccctatgtc       600
     gaacgtatga acgctagcct ctactactac aagggctact cgttacggga agaaaatccc       660
     cgattttcgg attggtttga tgccatggaa agtcggccta cttatcgggg gactcaaagc       720
     gacttccaca cccatgccca tgatttaccc ccgcagatgg gcggttgcta taagaacaac       780
     gatccacaga cgcccatcaa tatgagtcga gtggataatg gtccttggtc agaattgccg       840
     gatgtgacct atccagaacc cgaaacctct cgggcggaag cattacatcg agtggtgaag       900
     catcacgaga atattattaa ggtcaatccg accaaggatg agttaattga cgaagctctg       960
     cgctgtgctc tcactcattt gattacgggt gaagtttgca cgcctccctc tggctcggat      1020
     cttggcttgc gttacttgcg cgatcgcatc agtgttccac gtgatatgtc catctatgca      1080
     gctaagcgtt tgaaggaatc cctggaagca acagccgctc ttgtgggcaa tcgtcagggg      1140
     acacctatcc ctgtgcgtca ccgccgtgac caagacccca ccaattttgc caaggcataa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page