(data stored in ACNUC5340 zone)

EMBL: CP000828.PE72

CP000828.PE72        Location/Qualifiers
FT   CDS_pept        81323..83506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0075"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25163"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B0C551"
FT                   /protein_id="ABW25163.1"
FT                   /translation="MNSKATFLQAAIIWTCLFSPTLAQITSDGTTGSIVNQNNSRFQIE
FT                   GGVTRGNTLFHSFEKFSIPTNNQAYFTNPSGINLILSRVTGKGISNINGTLGVEGGADL
FT                   FLMNPNGIIFGPNASLDLNGSFLATTGSSFVFEDGKTFSATNPTSVPNFKVSVPLGIQF
FT                   GNVAAEIKVQARSGISYSPYKSYFECDCGLSINSGNTISFLSGDFTSERGVINAPNGNI
FT                   EIGSVDADSFVNLNPFTSGWSLGYSKVNSFKDISLSGGYIYNSNYSGKAGNRIRFYSRK
FT                   QIIRDKALIKTFSYNNGIRGKVLINAAESVSISSGGKIISWSGDFLGSDQSIGGDIEIN
FT                   TGSLSISNLGIIFTDSVNQSTGGNINIQSKDLKLTNGGRIKTIALDSGSAGNINIQVSD
FT                   STNISGKDGYFDTHFNNKIYVDSGISSTSYGVGKTGNLSLSTKDIEISNGAGIGVLGLG
FT                   NGPTGFLNIKGENLTLNNNAYISMKVTNNKLGNLNIDMSNLLLMNNQSKITYEAEGLGI
FT                   GGKASISAPMIVAFPNENSDIILDAPMADTSINAKEVLGFTKNSKPTKMSDIVVNSEDD
FT                   RELVGEYGRTSRLKVSEYREAPVQPQRIVKGCRPGQALGNGHFAYKGKGGLPPNPYQNR
FT                   TMPAVWQDLRLHDLESNSVNKYIKLSHQISKAIRDENKHQTPRESVVEKNIVAEEEIIE
FT                   AKGWIEDKKGQIILTSSPKKNVVTANYQPTATC"
     atgaatagca aagccacctt tctccaagca gccataattt ggacgtgtct cttctcgccg        60
     accttagccc aaatcacctc agatgggacg acaggaagca tcgtcaacca aaacaactca       120
     agatttcaaa ttgagggagg ggtaactaga gggaacaccc tgtttcacag tttcgagaaa       180
     tttagtatcc ccacaaacaa tcaagcctac tttactaatc ccagtgggat caacttgata       240
     ttgtctcgtg taacgggtaa aggaatatca aatataaatg gcactttggg ggttgaggga       300
     ggtgctgatt tatttttaat gaatccaaat ggaattatct ttggccctaa tgcgtcacta       360
     gatttgaatg gttcgttttt ggccaccact ggtagcagtt ttgtatttga ggatggtaag       420
     acttttagtg ccactaaccc tacatccgtt ccaaatttca aggttagtgt tccactaggg       480
     attcaatttg ggaatgtcgc tgcagaaatc aaggttcaag cacgaagtgg aatcagttat       540
     agtccttata aatcttactt tgagtgtgat tgtggcctat caatcaattc cggcaacaca       600
     atttcctttc ttagtggaga ctttacttct gaacgagggg ttataaatgc tccaaatgga       660
     aatattgaaa ttggtagtgt ggatgctgat agttttgtga atttaaatcc atttactagt       720
     ggttggtcat tgggatactc aaaagtaaat agcttcaaag atatatcttt atcaggtggg       780
     tatatttata attcaaatta ctctggcaaa gctggcaata ggattagatt ctattcaagg       840
     aaacaaatca ttcgagataa agcactaatc aagacatttt cttataacaa tggaattaga       900
     ggaaaagtac ttattaatgc agcggaatct gtaagcatat caagtggtgg aaaaattatt       960
     tcatggtcag gagatttttt aggaagtgat cagagtattg gtggggatat agagatcaat      1020
     acaggctcat tatctatatc aaatctaggg ataatattta ccgacagtgt caatcaatca      1080
     actggaggga atataaatat tcagtctaaa gatctgaagt taactaatgg aggtagaatt      1140
     aaaactattg ccttggattc tggtagtgct ggaaatatta atatccaagt ctcagatagc      1200
     actaatatct ctggaaagga tgggtatttt gatactcact ttaataataa aatatatgtt      1260
     gatagtggaa tttcttcaac ttcatatggg gtgggaaaaa ctggaaattt atccttgtcc      1320
     acaaaagata tagaaattag taacggagct ggaataggtg tattagggct tgggaatggt      1380
     cctacaggct ttctcaatat aaaaggggag aatttaactc ttaataataa tgcctatatt      1440
     tcaatgaagg taacgaataa taaacttggc aacttgaata ttgatatgag caatcttctt      1500
     ttaatgaata atcagagtaa aatcacctac gaagcagaag gacttggtat tggaggaaaa      1560
     gcaagcatta gtgcacctat gattgttgca tttcctaatg agaatagtga catcatctta      1620
     gatgctccta tggcagatac ttcaatcaat gctaaagaag tattaggttt cacaaaaaac      1680
     tccaaaccaa ctaagatgag tgatattgtc gttaactcgg aagatgatcg tgagttagta      1740
     ggagaatatg ggcggacttc taggttaaaa gtatctgaat atagagaagc tccggttcaa      1800
     ccacagagaa tcgttaaagg atgtcgccct ggtcaagctt tagggaacgg acattttgcc      1860
     tataaaggca aaggtggatt acctcctaat ccatatcaga accgaactat gccagccgtt      1920
     tggcaagatc tacgattgca tgatttagaa tcaaattcag ttaataagta cataaaacta      1980
     tctcatcaga tatctaaagc gattagggac gaaaataagc atcaaacgcc aagagaatca      2040
     gttgttgaaa aaaatattgt tgctgaggaa gaaattattg aagcgaaagg ctggattgaa      2100
     gataagaaag ggcagataat tctgacttct tctccaaaaa agaatgtcgt caccgccaat      2160
     tatcaaccga cagcaacttg ttaa                                             2184
//

If you have problems or comments...

PBIL Back to PBIL home page