(data stored in ACNUC8465 zone)

EMBL: CP000828.PE725

CP000828.PE725       Location/Qualifiers
FT   CDS_pept        complement(750364..752166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0772"
FT                   /product="molybdate ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25816"
FT                   /db_xref="GOA:B0CFC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFC9"
FT                   /protein_id="ABW25816.1"
FT                   /translation="MNIAPLWTSLRIAAIATGITFISGVAVAYAMHRYRGNGKAVMESI
FT                   LLIPLVLPPTVLGFMLLFLLGTQGPIGRLLTPLGLNPVFTWYAAVITATVVSFPLQYKT
FT                   ALGAFQQLDPNLPAAARTLGASEWTVFRQVILPLAGPGILAGTSLAFARALGEFGATLM
FT                   LAGNIPGQTQTIPMAIYFAVEGGAVEEALIWCSFTLFVSLGFLVGVNLWLSQKPRCLKF
FT                   RRRRPLRPRLLPDASYSSADQGLWVDLQKRVAGFQLDISFQTQETTLGVLGASGAGKSM
FT                   LLRCIAGIETPDRGRIVLNGRVLFDSAQGINIPSCDRNIGILFQNYALFPHLTAAENIA
FT                   FALSAGRSLNTTKVTSHLAPLQLADYGHRLPQELSGGQQQRVALARALASRPQLLLFDE
FT                   PFSALDTHLRNQIEKGMVSRLSTFDGMTLWVTHNVEEAYRLCDQLMVVEQGKPSTLRPK
FT                   HQILEQPETLSIAQLTGCKNFSRIQQSGPEEVFALDWECPLQTLEPIRPHHSQIGIRAH
FT                   QIRFLDLEVPVTPPSNTFLGWLAMTRETPHRMTLYLKLHSPPTHAEDYYLQAEVFKDKW
FT                   QQLKNLPFPWSITLDPMNILLLRE"
     gtgaacattg cccccctgtg gacctctttg aggattgctg cgatcgcaac gggtatcact        60
     tttatctcgg gagtggcagt ggcctacgcc atgcaccgct atcggggcaa tggcaaagcg       120
     gtgatggaga gtatcctcct gatccctttg gtcctacccc ccactgtgtt ggggtttatg       180
     ctcctcttcc ttctggggac tcaaggtccc atcggtcggc tcttaacccc tttgggattg       240
     aaccctgtat ttacttggta tgctgctgtg attacagcga cggtcgtatc tttccctttg       300
     caatacaaaa ccgcgttggg ggctttccaa cagctcgatc ccaatctgcc agcggcggct       360
     cgcacgttgg gggcatccga atggaccgta tttcgacaag tgatcttacc cttggcaggg       420
     ccaggcatat tggccggtac aagtctggcc tttgcccgag ccctggggga atttggcgcc       480
     accctgatgt tggcggggaa tattccaggg cagactcaaa ccattccaat ggccatttat       540
     tttgccgttg aaggtggggc cgttgaggaa gcattgattt ggtgcagctt cactcttttc       600
     gttagtttag gattcctggt gggggtgaat ctttggctca gtcaaaaacc tcgctgtcta       660
     aagttccgtc gtcgccgccc tttgagaccc agattgctcc cagatgcttc ctactcgtct       720
     gctgatcagg gcttatgggt tgatttgcaa aagcgagtgg ctggattcca gctggatatc       780
     tccttccaaa cccaagaaac gactctgggg gtgttgggag cgtcaggggc tggaaaaagt       840
     atgctccttc gctgtattgc tggcattgag actcctgatc ggggcaggat tgttctgaat       900
     ggtcgagtgc tgtttgattc tgcgcagggt attaatatac cgagttgcga tcgcaacatt       960
     ggcatcctgt tccaaaacta tgccttgttc ccccacctca ccgctgctga gaatattgcc      1020
     tttgccttat cagcagggcg atcgttaaat accactaaag tgacatccca cttagcaccg      1080
     ctgcagttgg ctgactacgg ccaccgcttg ccccaggaat tatctggagg acagcaacag      1140
     cgggtagccc tcgctcgggc cctcgcaagt cggccccaac tcttgctgtt tgatgaaccc      1200
     ttctcagcct tagataccca ccttcgtaac cagatcgaga aagggatggt atctcgtcta      1260
     tctacttttg atggcatgac cctgtgggtc actcacaatg tggaagaagc ctatcgactc      1320
     tgtgatcagt tgatggtggt ggagcaaggc aaaccctcta ccttacgccc caaacatcaa      1380
     atcctagaac agcccgaaac cctcagtatt gcccaactga cgggctgtaa aaacttctcc      1440
     cgcatccagc agagtggccc ggaagaggta tttgccctgg actgggagtg ccccctacaa      1500
     accttggagc ctattcggcc ccaccattct caaattggta ttcgagccca tcaaattcgg      1560
     tttttagatt tagaagtacc cgtaacgccc cctagtaata cttttctagg ctggctagcg      1620
     atgacccggg aaactcctca ccggatgacc ctttatttaa aactccattc tcctcccacc      1680
     cacgcagaag attactatct tcaggctgaa gtattcaaag ataaatggca acagctcaaa      1740
     aatctgcctt ttccctggtc tattaccctt gaccccatga acattttatt acttcgggag      1800
     tag                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page