(data stored in ACNUC5340 zone)

EMBL: CP000828.PE74

CP000828.PE74        Location/Qualifiers
FT   CDS_pept        83717..84205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25165"
FT                   /db_xref="UniProtKB/TrEMBL:B0C553"
FT                   /protein_id="ABW25165.1"
FT                   /translation="MNKTVLCIPTALAWMLLLSPGQAQQAPIKSISAQRQNSALATHTS
FT                   RTQKLQAKKNCHTNQPSVYRPSNPIRTIQSPTPQQQRPVRTAVWQDLRSPGSTSSSIDL
FT                   HESELSNTAARSYQTTLPKRPVIVEAQGWTRDKQGRVFLTSRFSRFRKNRAVPSNGEC"
     atgaacaaga ctgttttgtg catcccaaca gcgttagcat ggatgttgct tctctctcca        60
     ggccaagccc aacaagcacc tataaaatca atctcagcgc aacgacagaa ctctgcctta       120
     gccacacaca ccagcagaac tcaaaaatta caggcaaaga agaactgcca tacaaatcaa       180
     ccctcggtat accgtcccag caatcctatc cgtaccatcc aatcccccac acctcaacag       240
     cagcgaccag tcagaactgc ggtctggcaa gatttacgat cgcctggttc cacttcatcc       300
     tccattgacc ttcatgagtc agaattatcc aatactgctg cccggagcta ccaaacaaca       360
     ttgcctaaac gccccgttat tgtagaagcc caaggttgga ctcgggacaa gcaaggccgc       420
     gtcttcttaa cttcaaggtt ctctagattt agaaagaata gagctgttcc atccaatggg       480
     gaatgttga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page