(data stored in ACNUC27125 zone)

EMBL: CP000828.PE77

CP000828.PE77        Location/Qualifiers
FT   CDS_pept        85674..86513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25168"
FT                   /db_xref="GOA:B0C556"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0C556"
FT                   /protein_id="ABW25168.1"
FT                   /translation="MPILVVLALLIALIAILFALQNAYSVPVSFLIWRFDGSLALILLL
FT                   TLTLGVIIGLLVTTPTIIKRGWVSSRQKRQLSQLEEDYQGQAQDASSQKKKLDLMHSAQ
FT                   MHLFSALRLTEPKTGLLEYQLLDQVLTHTLNNLNPDSAWHRSICLFVMDIDDAPSSNDG
FT                   KARAVWPIITDRIQRQLSPRSWLHFDGGHRLYCVTLGMAIEAAADYGEFLSTTLDAPLQ
FT                   LVDASEISVSLKIGGAIARNNTTVTSQQLISQAEQMLEKSSLWGRSRFRMVEAGASS"
     atgcctatct tagttgttct cgccctactt atcgccctga ttgctatcct atttgcgttg        60
     caaaatgctt attcggttcc ggtcagcttt ttaatttggc gatttgacgg ttctttagcc       120
     cttattctcc tgctaacgct aaccttaggg gtgattatcg gcttgttggt cacaactccc       180
     accatcatta aacgggggtg ggtttcttct cgccagaagc ggcaactaag tcagctagaa       240
     gaagactatc aagggcaagc gcaagatgca tctagccaga agaaaaagct tgatttgatg       300
     cattcggccc agatgcatct attttcagct cttagattaa cggaacccaa aactggacta       360
     ttggaatatc aactgctgga tcaggttctc acccatacct tgaataactt gaaccctgat       420
     tcggcctggc atcgctcgat ctgcttattt gtgatggata ttgatgatgc ccctagttct       480
     aatgatggca aagccagagc ggtttggccg atcattactg atcggataca gcgtcagctt       540
     tctccacgca gctggcttca ttttgatggt ggccatcgtt tgtattgcgt caccctagga       600
     atggccattg aagcagcggc tgactacgga gaatttctat ccacaacttt agatgccccc       660
     ttacagctcg tggatgcgtc agagatctct gtgagcttga agattggggg tgcgatcgca       720
     agaaacaaca ccaccgttac cagtcaacag cttatttccc aagccgagca aatgctagag       780
     aaatcaagtc tttggggacg gagtcgcttt cgcatggtgg aggcaggtgc ttcttcttag       840
//

If you have problems or comments...

PBIL Back to PBIL home page