(data stored in ACNUC27125 zone)

EMBL: CP000828.PE81

CP000828.PE81        Location/Qualifiers
FT   CDS_pept        89647..91185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0084"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25172"
FT                   /db_xref="GOA:B0C560"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:B0C560"
FT                   /protein_id="ABW25172.1"
FT                   /translation="MTLTAFNWPQLQNGSDIRGVALEGVEGEAVNLTPEIAQILGMAFV
FT                   HWLSQTLNKSTSELTVGVGRDSRISGPTLMDAVLAGITKMGSNGYNFGLASTPAMFKST
FT                   VTDGFNCDGAIMLTASHLPFNRNGLKFFTAQGGLGKGDITQILSLAAEQTFEKAADPGQ
FT                   VSEHNFIGVYAAELVSQIRAAVNHPDQFEQPLQGLHIVVDAGNGAGGFYAEQVLKPLGA
FT                   DITGSQFLDPDGTFPNHIPNPENKEAMAAICQAVTEQQADFGIIFDTDVDRAAAVDHLG
FT                   QDLNRNRLIALISAVVLREHPGSTIVTDSITSDGLSQFIGDELGGVHHRFKRGYKNVIN
FT                   ESVRLNQSGQESWLAIETSGHGAMKENYFLDDGAYLISKLLVELAKSKMAGRNITDLIA
FT                   NLTEPQESEEYRIKIQTDDFKAHGNSVISKLEEFAGQQTDWQIVPNNYEGIRIALNSPS
FT                   EQGWLLLRLSLHDPVLPLNIESNVEGGVASISAKLTSFFQSIDGLNLPPELISS"
     atgaccctga ccgcatttaa ctggcctcaa cttcagaatg gttcagatat tcgaggcgtt        60
     gcattagagg gggttgaagg ggaagccgta aacctaaccc cagagatcgc ccagatccta       120
     ggaatggctt ttgtccattg gctctcccaa actctgaata aatctactag tgaactaacc       180
     gttggtgtgg gtcgagatag ccgcatttct ggccccactt tgatggacgc tgttctggcc       240
     ggaattacca aaatggggag taacggctat aactttgggt tagcctccac cccagccatg       300
     tttaaaagca cggttaccga tggctttaac tgtgatgggg ctattatgct aaccgccagt       360
     catttgccct ttaatcgcaa tggcctcaag ttctttaccg cccaaggggg cctaggcaaa       420
     ggcgatatca cccaaatcct cagtctggct gctgagcaga catttgaaaa agctgcagat       480
     ccgggtcagg tgtctgagca taactttatt ggcgtgtacg cagcagaact cgtcagccag       540
     attcgcgcag ccgttaatca tccagatcag tttgagcaac ccttgcaagg gctccacatt       600
     gtggtcgatg ctggcaatgg agctggaggg ttttatgcgg agcaagtctt aaagcccctg       660
     ggagcagata taacgggcag tcaattctta gacccagatg gcacgttccc caaccatatt       720
     ccaaatcctg agaacaaaga agcaatggcg gccatttgcc aagccgtaac agaacagcag       780
     gctgactttg gcattatttt cgatacagat gttgatcggg ctgctgctgt cgatcatttg       840
     ggtcaagacc tcaatcgcaa tcggctaatt gccttgatct ctgctgtggt attgagagaa       900
     catccgggct ccaccattgt tacggattcc attacctccg atgggctctc ccaatttatt       960
     ggagatgagt taggcggcgt ccatcatcgg tttaagcggg gctacaaaaa tgtgatcaat      1020
     gagtccgttc gcttaaacca atctggtcaa gaatcttggt tagccattga gacctccggt      1080
     cacggggcga tgaaggagaa ctattttctg gatgatgggg cttatttgat cagtaaactg      1140
     cttgtcgaac tggctaagtc taagatggca ggtcgcaaca tcacggactt gatcgccaac      1200
     ctcacagaac ctcaggaaag tgaagaatat cgcatcaaga tccagacgga tgattttaaa      1260
     gcccatggca actcggtgat ttctaagtta gaagaatttg ctggtcaaca aacagactgg      1320
     cagatcgttc ccaataacta tgaagggatt cggatcgcct taaactcgcc ctcagagcaa      1380
     ggctggttgt tactgcgatt atcactccac gatcccgttt tacctctaaa tattgaatcc      1440
     aatgtagagg gaggtgtggc cagtatttcg gctaaactca cttccttttt ccaaagtatc      1500
     gatggactga acttgcctcc agagcttatc agttcctag                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page